BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041182
(155 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4ACQ|A Chain A, Alpha-2 Macroglobulin
pdb|4ACQ|B Chain B, Alpha-2 Macroglobulin
pdb|4ACQ|C Chain C, Alpha-2 Macroglobulin
pdb|4ACQ|D Chain D, Alpha-2 Macroglobulin
Length = 1451
Score = 28.9 bits (63), Expect = 1.1, Method: Composition-based stats.
Identities = 11/32 (34%), Positives = 20/32 (62%)
Query: 57 QGVVRKILILSPESELKRGSIYFLIPASSLPG 88
+ V + +L++ P++EL S+Y L+P L G
Sbjct: 575 RAVDQSVLLMKPDAELSASSVYNLLPEKDLTG 606
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.138 0.420
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,458,222
Number of Sequences: 62578
Number of extensions: 101308
Number of successful extensions: 124
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 123
Number of HSP's gapped (non-prelim): 1
length of query: 155
length of database: 14,973,337
effective HSP length: 91
effective length of query: 64
effective length of database: 9,278,739
effective search space: 593839296
effective search space used: 593839296
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)