BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041202
(166 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1COL|A Chain A, Refined Structure Of The Pore-Forming Domain Of Colicin A
At 2.4 Angstroms Resolution
pdb|1COL|B Chain B, Refined Structure Of The Pore-Forming Domain Of Colicin A
At 2.4 Angstroms Resolution
Length = 204
Score = 28.5 bits (62), Expect = 1.7, Method: Compositional matrix adjust.
Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 4/53 (7%)
Query: 118 QKTGSVPEMADQAKKRVAGMAD----YVGQKTKEVGQDIQSKVHEAGGKTGRT 166
+K E+ ++ + +AGM D ++G K K + +DI + GKT R+
Sbjct: 3 EKAKDERELLEKTSELIAGMGDKIGEHLGDKYKAIAKDIADNIKNFQGKTIRS 55
>pdb|3BLV|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate Bound In The
Regulatory Subunits
pdb|3BLV|D Chain D, Yeast Isocitrate Dehydrogenase With Citrate Bound In The
Regulatory Subunits
pdb|3BLV|F Chain F, Yeast Isocitrate Dehydrogenase With Citrate Bound In The
Regulatory Subunits
pdb|3BLV|H Chain H, Yeast Isocitrate Dehydrogenase With Citrate Bound In The
Regulatory Subunits
Length = 354
Score = 26.9 bits (58), Expect = 4.9, Method: Compositional matrix adjust.
Identities = 13/36 (36%), Positives = 22/36 (61%)
Query: 96 LTSGAFGLTALSSLSWVLSILRQKTGSVPEMADQAK 131
L++G+ GLT +++ +SI GS P++A Q K
Sbjct: 257 LSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDK 292
>pdb|3BLW|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLW|D Chain D, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLW|F Chain F, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLW|H Chain H, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLW|J Chain J, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLW|L Chain L, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLW|N Chain N, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLW|P Chain P, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound
In The Regulatory Subunits
pdb|3BLX|B Chain B, Yeast Isocitrate Dehydrogenase (Apo Form)
pdb|3BLX|D Chain D, Yeast Isocitrate Dehydrogenase (Apo Form)
pdb|3BLX|F Chain F, Yeast Isocitrate Dehydrogenase (Apo Form)
pdb|3BLX|H Chain H, Yeast Isocitrate Dehydrogenase (Apo Form)
pdb|3BLX|J Chain J, Yeast Isocitrate Dehydrogenase (Apo Form)
pdb|3BLX|L Chain L, Yeast Isocitrate Dehydrogenase (Apo Form)
pdb|3BLX|N Chain N, Yeast Isocitrate Dehydrogenase (Apo Form)
pdb|3BLX|P Chain P, Yeast Isocitrate Dehydrogenase (Apo Form)
Length = 354
Score = 26.9 bits (58), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 13/36 (36%), Positives = 22/36 (61%)
Query: 96 LTSGAFGLTALSSLSWVLSILRQKTGSVPEMADQAK 131
L++G+ GLT +++ +SI GS P++A Q K
Sbjct: 257 LSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDK 292
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.134 0.377
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,768,643
Number of Sequences: 62578
Number of extensions: 117987
Number of successful extensions: 283
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 280
Number of HSP's gapped (non-prelim): 5
length of query: 166
length of database: 14,973,337
effective HSP length: 92
effective length of query: 74
effective length of database: 9,216,161
effective search space: 681995914
effective search space used: 681995914
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)