BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041240
         (113 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ZKJ|A Chain A, Structural Basis For The Extended Substrate Spectrum Of
           Cmy- 10, A Plasmid-encoded Class C Beta-lactamase
          Length = 359

 Score = 26.9 bits (58), Expect = 2.8,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 6/68 (8%)

Query: 36  FGRLAVEI--DPNKPLISQFFLDGKLQKVEYEGLPNTSFLCGKYGHSKDICPNRTE---- 89
           FG LA      P  PL+ Q  L G      Y  +P  +     YG+SK+  P R      
Sbjct: 159 FGHLAASSLKQPFAPLMEQTLLPGLGMHHTYVNVPKQAMASYAYGYSKEDKPIRVNPGML 218

Query: 90  EDHALGFQ 97
            D A G +
Sbjct: 219 ADEAYGIK 226


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.138    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,507,072
Number of Sequences: 62578
Number of extensions: 131318
Number of successful extensions: 264
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 264
Number of HSP's gapped (non-prelim): 1
length of query: 113
length of database: 14,973,337
effective HSP length: 77
effective length of query: 36
effective length of database: 10,154,831
effective search space: 365573916
effective search space used: 365573916
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)