Query         041240
Match_columns 113
No_of_seqs    107 out of 284
Neff          6.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:08:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041240.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041240hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14392 zf-CCHC_4:  Zinc knuck  99.7 3.6E-17 7.7E-22   98.3   3.1   44   43-86      1-49  (49)
  2 PF14111 DUF4283:  Domain of un  99.1 9.4E-11   2E-15   82.6   4.0   42    1-42    112-153 (153)
  3 PF00098 zf-CCHC:  Zinc knuckle  97.4 6.6E-05 1.4E-09   36.3   1.2   17   70-86      2-18  (18)
  4 PF13696 zf-CCHC_2:  Zinc knuck  95.5  0.0063 1.4E-07   33.6   1.0   20   69-88      9-28  (32)
  5 PF15288 zf-CCHC_6:  Zinc knuck  95.0   0.023 5.1E-07   32.8   2.3   20   69-88      2-23  (40)
  6 smart00343 ZnF_C2HC zinc finge  94.6   0.015 3.2E-07   29.9   0.7   18   70-87      1-18  (26)
  7 COG5082 AIR1 Arginine methyltr  91.0    0.12 2.5E-06   39.2   1.3   16   69-84     98-113 (190)
  8 COG5082 AIR1 Arginine methyltr  91.0   0.099 2.1E-06   39.6   0.9   22   64-85     56-77  (190)
  9 PF13917 zf-CCHC_3:  Zinc knuck  89.7    0.18 3.8E-06   29.4   1.1   19   68-86      4-22  (42)
 10 PTZ00368 universal minicircle   88.9    0.23   5E-06   35.2   1.4   18   69-86    130-147 (148)
 11 KOG4400 E3 ubiquitin ligase in  84.5    0.45 9.9E-06   36.7   1.0   25   62-87    138-162 (261)
 12 PF10083 DUF2321:  Uncharacteri  81.9    0.54 1.2E-05   34.6   0.5   31   45-76     45-76  (158)
 13 PF14787 zf-CCHC_5:  GAG-polypr  80.6     1.2 2.5E-05   25.2   1.5   25   68-92      2-26  (36)
 14 KOG0109 RNA-binding protein LA  79.7     1.2 2.5E-05   36.3   1.7   23   68-90    160-182 (346)
 15 PTZ00368 universal minicircle   78.5     1.1 2.4E-05   31.6   1.2   16   71-86     30-45  (148)
 16 COG4306 Uncharacterized protei  74.3     1.1 2.4E-05   32.3   0.2   30   46-76     46-76  (160)
 17 PLN00032 DNA-directed RNA poly  72.8     1.5 3.3E-05   28.2   0.6   15   67-81      3-18  (71)
 18 PF01194 RNA_pol_N:  RNA polyme  71.9     1.8 3.8E-05   27.1   0.7   14   67-80      3-17  (60)
 19 PRK04016 DNA-directed RNA poly  71.1     1.8 3.9E-05   27.2   0.6   13   67-79      3-16  (62)
 20 COG5222 Uncharacterized conser  69.8     2.2 4.8E-05   35.0   1.0   20   69-88    177-196 (427)
 21 KOG4400 E3 ubiquitin ligase in  68.9     3.8 8.3E-05   31.6   2.2   25   67-91    163-187 (261)
 22 COG1644 RPB10 DNA-directed RNA  67.7     2.2 4.9E-05   26.8   0.5   16   67-82      3-19  (63)
 23 KOG0341 DEAD-box protein abstr  64.0       3 6.6E-05   35.6   0.8   21   68-88    570-590 (610)
 24 KOG3497 DNA-directed RNA polym  63.9     2.5 5.5E-05   26.7   0.2   11   67-77      3-13  (69)
 25 smart00647 IBR In Between Ring  63.4     4.2 9.1E-05   24.0   1.1   18   67-84     47-64  (64)
 26 PF01191 RNA_pol_Rpb5_C:  RNA p  63.1      11 0.00024   24.3   3.1   40    1-40     34-73  (74)
 27 COG2012 RPB5 DNA-directed RNA   61.7      14  0.0003   24.3   3.4   40    1-40     40-79  (80)
 28 KOG2044 5'-3' exonuclease HKE1  59.7     5.5 0.00012   36.3   1.6   28   62-89    254-281 (931)
 29 COG1998 RPS31 Ribosomal protei  56.7     6.7 0.00015   23.7   1.2   17   59-75      7-26  (51)
 30 COG1940 NagC Transcriptional r  56.2      14  0.0003   28.6   3.2   82    3-88     90-192 (314)
 31 PRK09570 rpoH DNA-directed RNA  55.2      23 0.00049   23.2   3.6   41    1-41     37-77  (79)
 32 KOG2560 RNA splicing factor -   50.8     5.5 0.00012   34.2   0.2   20   69-88    113-132 (529)
 33 PF00567 TUDOR:  Tudor domain;   45.5      37  0.0008   21.5   3.5   46   33-78     65-121 (121)
 34 COG5179 TAF1 Transcription ini  40.8      15 0.00032   33.2   1.2   25   68-92    937-963 (968)
 35 PF01485 IBR:  IBR domain;  Int  40.6      11 0.00024   22.0   0.4   18   67-84     47-64  (64)
 36 KOG0119 Splicing factor 1/bran  36.9      16 0.00035   31.7   0.9   18   70-87    287-304 (554)
 37 KOG2673 Uncharacterized conser  33.7      22 0.00047   30.5   1.2   18   71-88    131-148 (485)
 38 PF01188 MR_MLE:  Mandelate rac  32.7      53  0.0012   19.8   2.6   24    2-25     44-67  (67)
 39 KOG2985 Uncharacterized conser  31.0      11 0.00025   30.1  -0.9   29   65-93     78-106 (306)
 40 PF14205 Cys_rich_KTR:  Cystein  30.0      24 0.00051   21.7   0.6   15   62-76     22-36  (55)
 41 PF05515 Viral_NABP:  Viral nuc  30.0      32 0.00069   24.4   1.3   19   69-87     63-81  (124)
 42 KOG4399 C2HC-type Zn-finger pr  29.9      25 0.00054   28.3   0.9   20   68-87    261-280 (325)
 43 PF13248 zf-ribbon_3:  zinc-rib  28.8      20 0.00043   18.2   0.1    9   68-76     16-24  (26)
 44 PRK09698 D-allose kinase; Prov  28.0 1.1E+02  0.0023   23.5   4.1   78    8-86     94-188 (302)
 45 PF09297 zf-NADH-PPase:  NADH p  27.6      26 0.00057   18.4   0.5   13   68-80      3-15  (32)
 46 PF10741 T2SM_b:  Type II secre  26.5 1.2E+02  0.0025   20.1   3.6   42    9-50     20-61  (110)
 47 PF14599 zinc_ribbon_6:  Zinc-r  25.9      41 0.00089   20.8   1.2   20   58-77     38-57  (61)
 48 PF13821 DUF4187:  Domain of un  25.4      40 0.00088   20.3   1.1   25   67-91     26-54  (55)
 49 PF02591 DUF164:  Putative zinc  25.1      29 0.00063   20.5   0.4   11   67-77     45-55  (56)
 50 smart00769 WHy Water Stress an  24.1      93   0.002   20.1   2.7   33   35-67     13-45  (100)
 51 PRK15329 chaperone protein Sic  24.0      71  0.0015   23.1   2.2   22    8-29      5-26  (138)
 52 COG1867 TRM1 N2,N2-dimethylgua  23.4      40 0.00088   28.2   1.0   39    4-45    180-225 (380)
 53 KOG3794 CBF1-interacting corep  22.6      40 0.00086   28.6   0.8   22   68-89    124-147 (453)
 54 PF14803 Nudix_N_2:  Nudix N-te  22.6      33 0.00072   18.8   0.3    8   69-76      1-8   (34)
 55 PF04246 RseC_MucC:  Positive r  22.2 2.5E+02  0.0054   19.2   4.7   26   55-85      4-29  (135)
 56 PF05037 DUF669:  Protein of un  21.3      51  0.0011   23.1   1.1   39    6-44     71-113 (141)
 57 PRK00432 30S ribosomal protein  20.1      60  0.0013   19.1   1.0   11   66-76     18-28  (50)
 58 cd07153 Fur_like Ferric uptake  20.1 1.5E+02  0.0032   19.3   3.1   15   67-81     72-86  (116)

No 1  
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=99.67  E-value=3.6e-17  Score=98.29  Aligned_cols=44  Identities=45%  Similarity=0.859  Sum_probs=40.2

Q ss_pred             ecCCCCceeEEEEc---Ce--EEEEEEccccccccccCccccCCCCCCC
Q 041240           43 IDPNKPLISQFFLD---GK--LQKVEYEGLPNTSFLCGKYGHSKDICPN   86 (113)
Q Consensus        43 iDl~kpL~~~v~v~---g~--~~~v~YE~Lp~fC~~Cg~iGH~~~~C~~   86 (113)
                      ||++|||.+++.|+   |.  ++.|+|||||.||++||.+||..++|++
T Consensus         1 id~~kPL~~~i~v~~~~g~~~~~~v~YE~lp~~C~~C~~~gH~~~~C~k   49 (49)
T PF14392_consen    1 IDVSKPLRREIKVKFPEGESFWVKVKYERLPRFCFHCGRIGHSDKECPK   49 (49)
T ss_pred             CCCCCcccceEEEEeCCCcEEEEEEEECCcChhhcCCCCcCcCHhHcCC
Confidence            69999999999884   32  8999999999999999999999999985


No 2  
>PF14111 DUF4283:  Domain of unknown function (DUF4283)
Probab=99.09  E-value=9.4e-11  Score=82.59  Aligned_cols=42  Identities=33%  Similarity=0.592  Sum_probs=41.0

Q ss_pred             CCcccccHHHHHHHhhccCceEEEecCCCcccccceeEEEEE
Q 041240            1 MALHYYNKKILRMLGQIFGRVFKTDYNTESASRDKFGRLAVE   42 (113)
Q Consensus         1 LP~~y~~~~~l~~I~~~iG~~l~vD~~t~~~~~g~faRV~Ve   42 (113)
                      ||+.||+++++++||+.+|+|+++|.+|.+..+++||||+|+
T Consensus       112 lP~~~~~~~~~~~i~~~iG~~i~vD~~t~~~~~~~~~Rv~V~  153 (153)
T PF14111_consen  112 LPLHLWSEEILKAIGSKIGEPIEVDENTLKRTRLDFARVRVE  153 (153)
T ss_pred             CCHHHhhhHHHHHHHHhcCCeEEEEcCCCCcccccEEEEEEC
Confidence            799999999999999999999999999999999999999996


No 3  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=97.43  E-value=6.6e-05  Score=36.32  Aligned_cols=17  Identities=41%  Similarity=0.913  Sum_probs=15.8

Q ss_pred             cccccCccccCCCCCCC
Q 041240           70 TSFLCGKYGHSKDICPN   86 (113)
Q Consensus        70 fC~~Cg~iGH~~~~C~~   86 (113)
                      .||+||..||...+||.
T Consensus         2 ~C~~C~~~GH~~~~Cp~   18 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCPK   18 (18)
T ss_dssp             BCTTTSCSSSCGCTSSS
T ss_pred             cCcCCCCcCcccccCcc
Confidence            69999999999999984


No 4  
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=95.54  E-value=0.0063  Score=33.58  Aligned_cols=20  Identities=30%  Similarity=0.637  Sum_probs=17.9

Q ss_pred             ccccccCccccCCCCCCCCC
Q 041240           69 NTSFLCGKYGHSKDICPNRT   88 (113)
Q Consensus        69 ~fC~~Cg~iGH~~~~C~~~~   88 (113)
                      ..|+.|+.-||..++||...
T Consensus         9 Y~C~~C~~~GH~i~dCP~~~   28 (32)
T PF13696_consen    9 YVCHRCGQKGHWIQDCPTNK   28 (32)
T ss_pred             CEeecCCCCCccHhHCCCCC
Confidence            47999999999999999943


No 5  
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=95.02  E-value=0.023  Score=32.82  Aligned_cols=20  Identities=30%  Similarity=0.685  Sum_probs=17.0

Q ss_pred             ccccccCccccCC--CCCCCCC
Q 041240           69 NTSFLCGKYGHSK--DICPNRT   88 (113)
Q Consensus        69 ~fC~~Cg~iGH~~--~~C~~~~   88 (113)
                      ..|..||-+||..  +.||...
T Consensus         2 ~kC~~CG~~GH~~t~k~CP~~~   23 (40)
T PF15288_consen    2 VKCKNCGAFGHMRTNKRCPMYC   23 (40)
T ss_pred             ccccccccccccccCccCCCCC
Confidence            4699999999987  6899864


No 6  
>smart00343 ZnF_C2HC zinc finger.
Probab=94.61  E-value=0.015  Score=29.93  Aligned_cols=18  Identities=39%  Similarity=0.866  Sum_probs=16.0

Q ss_pred             cccccCccccCCCCCCCC
Q 041240           70 TSFLCGKYGHSKDICPNR   87 (113)
Q Consensus        70 fC~~Cg~iGH~~~~C~~~   87 (113)
                      .|+.||..||..++|+..
T Consensus         1 ~C~~CG~~GH~~~~C~~~   18 (26)
T smart00343        1 KCYNCGKEGHIARDCPKX   18 (26)
T ss_pred             CCccCCCCCcchhhCCcc
Confidence            599999999999999843


No 7  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=91.00  E-value=0.12  Score=39.17  Aligned_cols=16  Identities=31%  Similarity=0.802  Sum_probs=8.7

Q ss_pred             ccccccCccccCCCCC
Q 041240           69 NTSFLCGKYGHSKDIC   84 (113)
Q Consensus        69 ~fC~~Cg~iGH~~~~C   84 (113)
                      ..|++||..||..++|
T Consensus        98 ~~C~~Cg~~GH~~~dC  113 (190)
T COG5082          98 KKCYNCGETGHLSRDC  113 (190)
T ss_pred             cccccccccCcccccc
Confidence            4455555555555555


No 8  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=90.98  E-value=0.099  Score=39.57  Aligned_cols=22  Identities=32%  Similarity=0.679  Sum_probs=18.9

Q ss_pred             EccccccccccCccccCCCCCC
Q 041240           64 YEGLPNTSFLCGKYGHSKDICP   85 (113)
Q Consensus        64 YE~Lp~fC~~Cg~iGH~~~~C~   85 (113)
                      +-.-..+||+||..||..++||
T Consensus        56 ~~~~~~~C~nCg~~GH~~~DCP   77 (190)
T COG5082          56 IREENPVCFNCGQNGHLRRDCP   77 (190)
T ss_pred             ccccccccchhcccCcccccCC
Confidence            3344579999999999999999


No 9  
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=89.71  E-value=0.18  Score=29.37  Aligned_cols=19  Identities=37%  Similarity=0.639  Sum_probs=17.4

Q ss_pred             cccccccCccccCCCCCCC
Q 041240           68 PNTSFLCGKYGHSKDICPN   86 (113)
Q Consensus        68 p~fC~~Cg~iGH~~~~C~~   86 (113)
                      ...|..|+..||...+|+.
T Consensus         4 ~~~CqkC~~~GH~tyeC~~   22 (42)
T PF13917_consen    4 RVRCQKCGQKGHWTYECPN   22 (42)
T ss_pred             CCcCcccCCCCcchhhCCC
Confidence            4689999999999999996


No 10 
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=88.95  E-value=0.23  Score=35.17  Aligned_cols=18  Identities=39%  Similarity=0.944  Sum_probs=10.5

Q ss_pred             ccccccCccccCCCCCCC
Q 041240           69 NTSFLCGKYGHSKDICPN   86 (113)
Q Consensus        69 ~fC~~Cg~iGH~~~~C~~   86 (113)
                      .+|++||..||..++||.
T Consensus       130 ~~C~~Cg~~gH~~~dCp~  147 (148)
T PTZ00368        130 KTCYNCGQTGHLSRDCPD  147 (148)
T ss_pred             CccccCCCcCcccccCCC
Confidence            456666666666666654


No 11 
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=84.50  E-value=0.45  Score=36.75  Aligned_cols=25  Identities=32%  Similarity=0.678  Sum_probs=20.3

Q ss_pred             EEEccccccccccCccccCCCCCCCC
Q 041240           62 VEYEGLPNTSFLCGKYGHSKDICPNR   87 (113)
Q Consensus        62 v~YE~Lp~fC~~Cg~iGH~~~~C~~~   87 (113)
                      +.+.+- .+||.||..||....|+..
T Consensus       138 ~~~~~~-~~Cy~Cg~~GH~s~~C~~~  162 (261)
T KOG4400|consen  138 VDGPKP-AKCYSCGEQGHISDDCPEN  162 (261)
T ss_pred             ccCCCC-CccCCCCcCCcchhhCCCC
Confidence            344444 7899999999999999964


No 12 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=81.87  E-value=0.54  Score=34.62  Aligned_cols=31  Identities=26%  Similarity=0.503  Sum_probs=23.5

Q ss_pred             CCCCceeEEEEcCe-EEEEEEccccccccccCc
Q 041240           45 PNKPLISQFFLDGK-LQKVEYEGLPNTSFLCGK   76 (113)
Q Consensus        45 l~kpL~~~v~v~g~-~~~v~YE~Lp~fC~~Cg~   76 (113)
                      -+-|++....++|. .+.-.|+ .|.||++||.
T Consensus        45 C~~~IrG~y~v~gv~~~g~~~~-~PsYC~~CGk   76 (158)
T PF10083_consen   45 CSTPIRGDYHVEGVFGLGGHYE-APSYCHNCGK   76 (158)
T ss_pred             CCCCCCCceecCCeeeeCCCCC-CChhHHhCCC
Confidence            45566777777775 4557888 9999999996


No 13 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=80.61  E-value=1.2  Score=25.17  Aligned_cols=25  Identities=32%  Similarity=0.452  Sum_probs=14.7

Q ss_pred             cccccccCccccCCCCCCCCCcccc
Q 041240           68 PNTSFLCGKYGHSKDICPNRTEEDH   92 (113)
Q Consensus        68 p~fC~~Cg~iGH~~~~C~~~~~~~~   92 (113)
                      |..|+.||+-.|-.++|......++
T Consensus         2 ~~~CprC~kg~Hwa~~C~sk~d~~G   26 (36)
T PF14787_consen    2 PGLCPRCGKGFHWASECRSKTDVDG   26 (36)
T ss_dssp             --C-TTTSSSCS-TTT---TCCCCC
T ss_pred             CccCcccCCCcchhhhhhhhhcccC
Confidence            5679999999999999998754443


No 14 
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]
Probab=79.69  E-value=1.2  Score=36.29  Aligned_cols=23  Identities=30%  Similarity=0.637  Sum_probs=19.5

Q ss_pred             cccccccCccccCCCCCCCCCcc
Q 041240           68 PNTSFLCGKYGHSKDICPNRTEE   90 (113)
Q Consensus        68 p~fC~~Cg~iGH~~~~C~~~~~~   90 (113)
                      +.-|+.||+-||-.++||.....
T Consensus       160 q~~cyrcGkeghwskEcP~~~~~  182 (346)
T KOG0109|consen  160 QSGCYRCGKEGHWSKECPVDRTG  182 (346)
T ss_pred             HHHheeccccccccccCCccCCC
Confidence            45799999999999999987543


No 15 
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=78.53  E-value=1.1  Score=31.65  Aligned_cols=16  Identities=38%  Similarity=0.976  Sum_probs=8.1

Q ss_pred             ccccCccccCCCCCCC
Q 041240           71 SFLCGKYGHSKDICPN   86 (113)
Q Consensus        71 C~~Cg~iGH~~~~C~~   86 (113)
                      ||.|+..||...+||.
T Consensus        30 C~~Cg~~GH~~~~Cp~   45 (148)
T PTZ00368         30 CYKCGEPGHLSRECPS   45 (148)
T ss_pred             CccCCCCCcCcccCcC
Confidence            4445555555555544


No 16 
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=74.30  E-value=1.1  Score=32.32  Aligned_cols=30  Identities=20%  Similarity=0.502  Sum_probs=20.3

Q ss_pred             CCCceeEEEEcCe-EEEEEEccccccccccCc
Q 041240           46 NKPLISQFFLDGK-LQKVEYEGLPNTSFLCGK   76 (113)
Q Consensus        46 ~kpL~~~v~v~g~-~~~v~YE~Lp~fC~~Cg~   76 (113)
                      +-|++....|+|. .+-=+|| .|.||.+||.
T Consensus        46 sasirgd~~vegvlglg~dye-~psfchncgs   76 (160)
T COG4306          46 SASIRGDYYVEGVLGLGGDYE-PPSFCHNCGS   76 (160)
T ss_pred             CCcccccceeeeeeccCCCCC-CcchhhcCCC
Confidence            3455555666664 3455777 7999999995


No 17 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=72.77  E-value=1.5  Score=28.23  Aligned_cols=15  Identities=40%  Similarity=0.862  Sum_probs=11.4

Q ss_pred             ccccccccCc-cccCC
Q 041240           67 LPNTSFLCGK-YGHSK   81 (113)
Q Consensus        67 Lp~fC~~Cg~-iGH~~   81 (113)
                      +|..||.||+ +||.-
T Consensus         3 iPVRCFTCGkvig~~w   18 (71)
T PLN00032          3 IPVRCFTCGKVIGNKW   18 (71)
T ss_pred             CceeecCCCCCcHHHH
Confidence            5889999997 45543


No 18 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=71.95  E-value=1.8  Score=27.08  Aligned_cols=14  Identities=43%  Similarity=0.997  Sum_probs=9.2

Q ss_pred             ccccccccCcc-ccC
Q 041240           67 LPNTSFLCGKY-GHS   80 (113)
Q Consensus        67 Lp~fC~~Cg~i-GH~   80 (113)
                      .|..||.||++ ||.
T Consensus         3 iPVRCFTCGkvi~~~   17 (60)
T PF01194_consen    3 IPVRCFTCGKVIGNK   17 (60)
T ss_dssp             -SSS-STTTSBTCGH
T ss_pred             CceecCCCCCChhHh
Confidence            58899999974 544


No 19 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=71.11  E-value=1.8  Score=27.24  Aligned_cols=13  Identities=38%  Similarity=0.904  Sum_probs=10.5

Q ss_pred             ccccccccCc-ccc
Q 041240           67 LPNTSFLCGK-YGH   79 (113)
Q Consensus        67 Lp~fC~~Cg~-iGH   79 (113)
                      +|..||.||+ +||
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            5889999997 455


No 20 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=69.82  E-value=2.2  Score=34.96  Aligned_cols=20  Identities=30%  Similarity=0.738  Sum_probs=18.1

Q ss_pred             ccccccCccccCCCCCCCCC
Q 041240           69 NTSFLCGKYGHSKDICPNRT   88 (113)
Q Consensus        69 ~fC~~Cg~iGH~~~~C~~~~   88 (113)
                      ..||.||--||-...||...
T Consensus       177 Y~CyRCGqkgHwIqnCpTN~  196 (427)
T COG5222         177 YVCYRCGQKGHWIQNCPTNQ  196 (427)
T ss_pred             eeEEecCCCCchhhcCCCCC
Confidence            48999999999999999764


No 21 
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=68.90  E-value=3.8  Score=31.58  Aligned_cols=25  Identities=36%  Similarity=0.772  Sum_probs=22.1

Q ss_pred             ccccccccCccccCCCCCCCCCccc
Q 041240           67 LPNTSFLCGKYGHSKDICPNRTEED   91 (113)
Q Consensus        67 Lp~fC~~Cg~iGH~~~~C~~~~~~~   91 (113)
                      .+..|+.|+..||...+|+.....+
T Consensus       163 ~~~~c~~c~~~~h~~~~C~~~~~~~  187 (261)
T KOG4400|consen  163 KGGTCFRCGKVGHGSRDCPSKQKSK  187 (261)
T ss_pred             CCCccccCCCcceecccCCcccccc
Confidence            5889999999999999999886653


No 22 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=67.73  E-value=2.2  Score=26.84  Aligned_cols=16  Identities=44%  Similarity=0.947  Sum_probs=12.0

Q ss_pred             ccccccccCc-cccCCC
Q 041240           67 LPNTSFLCGK-YGHSKD   82 (113)
Q Consensus        67 Lp~fC~~Cg~-iGH~~~   82 (113)
                      .|..||.||+ +||.-.
T Consensus         3 iPiRCFsCGkvi~~~w~   19 (63)
T COG1644           3 IPVRCFSCGKVIGHKWE   19 (63)
T ss_pred             CceEeecCCCCHHHHHH
Confidence            5889999997 566543


No 23 
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]
Probab=64.02  E-value=3  Score=35.57  Aligned_cols=21  Identities=29%  Similarity=0.605  Sum_probs=18.5

Q ss_pred             cccccccCccccCCCCCCCCC
Q 041240           68 PNTSFLCGKYGHSKDICPNRT   88 (113)
Q Consensus        68 p~fC~~Cg~iGH~~~~C~~~~   88 (113)
                      -.-|..||-+||...+||+..
T Consensus       570 ~kGCayCgGLGHRItdCPKle  590 (610)
T KOG0341|consen  570 EKGCAYCGGLGHRITDCPKLE  590 (610)
T ss_pred             ccccccccCCCcccccCchhh
Confidence            357999999999999999874


No 24 
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=63.88  E-value=2.5  Score=26.68  Aligned_cols=11  Identities=45%  Similarity=1.011  Sum_probs=9.3

Q ss_pred             ccccccccCcc
Q 041240           67 LPNTSFLCGKY   77 (113)
Q Consensus        67 Lp~fC~~Cg~i   77 (113)
                      +|..||.||++
T Consensus         3 iPiRCFtCGKv   13 (69)
T KOG3497|consen    3 IPIRCFTCGKV   13 (69)
T ss_pred             eeeEeeecccc
Confidence            58899999974


No 25 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=63.40  E-value=4.2  Score=23.96  Aligned_cols=18  Identities=28%  Similarity=0.213  Sum_probs=15.1

Q ss_pred             ccccccccCccccCCCCC
Q 041240           67 LPNTSFLCGKYGHSKDIC   84 (113)
Q Consensus        67 Lp~fC~~Cg~iGH~~~~C   84 (113)
                      -..||+.|+...|....|
T Consensus        47 ~~~fC~~C~~~~H~~~~C   64 (64)
T smart00647       47 GFSFCFRCKVPWHSPVSC   64 (64)
T ss_pred             CCeECCCCCCcCCCCCCC
Confidence            367999999999987766


No 26 
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=63.08  E-value=11  Score=24.34  Aligned_cols=40  Identities=25%  Similarity=0.203  Sum_probs=29.1

Q ss_pred             CCcccccHHHHHHHhhccCceEEEecCCCcccccceeEEE
Q 041240            1 MALHYYNKKILRMLGQIFGRVFKTDYNTESASRDKFGRLA   40 (113)
Q Consensus         1 LP~~y~~~~~l~~I~~~iG~~l~vD~~t~~~~~g~faRV~   40 (113)
                      ||.-.-++-+.+.+|..-|.++++...+......-+-|+.
T Consensus        34 LP~I~~~DPv~r~~g~k~GdVvkI~R~S~taG~~v~YR~V   73 (74)
T PF01191_consen   34 LPKILSSDPVARYLGAKPGDVVKIIRKSETAGEYVTYRLV   73 (74)
T ss_dssp             SSEEETTSHHHHHTT--TTSEEEEEEEETTTSEEEEEEEE
T ss_pred             CCcccccChhhhhcCCCCCCEEEEEecCCCCCCcEEEEEe
Confidence            6777888899999999999999999887654444444544


No 27 
>COG2012 RPB5 DNA-directed RNA polymerase, subunit H, RpoH/RPB5 [Transcription]
Probab=61.70  E-value=14  Score=24.33  Aligned_cols=40  Identities=20%  Similarity=0.223  Sum_probs=30.6

Q ss_pred             CCcccccHHHHHHHhhccCceEEEecCCCcccccceeEEE
Q 041240            1 MALHYYNKKILRMLGQIFGRVFKTDYNTESASRDKFGRLA   40 (113)
Q Consensus         1 LP~~y~~~~~l~~I~~~iG~~l~vD~~t~~~~~g~faRV~   40 (113)
                      ||-...++-+.+.|+.+.|.++++=........--|-|++
T Consensus        40 LPkI~~~DPva~~lgak~GdvVkIvRkS~TaGe~v~YR~V   79 (80)
T COG2012          40 LPKIKASDPVAKALGAKPGDVVKIVRKSPTAGESVYYRLV   79 (80)
T ss_pred             CCcccccChhHHHccCCCCcEEEEEecCCCCCceEEEEEe
Confidence            6777888889999999999999998876554444444543


No 28 
>KOG2044 consensus 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair; RNA processing and modification]
Probab=59.66  E-value=5.5  Score=36.33  Aligned_cols=28  Identities=29%  Similarity=0.682  Sum_probs=23.9

Q ss_pred             EEEccccccccccCccccCCCCCCCCCc
Q 041240           62 VEYEGLPNTSFLCGKYGHSKDICPNRTE   89 (113)
Q Consensus        62 v~YE~Lp~fC~~Cg~iGH~~~~C~~~~~   89 (113)
                      +-+.+-|..||.||..||..++|.-...
T Consensus       254 ~~~P~~~~~C~~cgq~gh~~~dc~g~~~  281 (931)
T KOG2044|consen  254 EFFPNKPRRCFLCGQTGHEAKDCEGKPR  281 (931)
T ss_pred             eecCCCcccchhhcccCCcHhhcCCcCC
Confidence            4458888999999999999999997744


No 29 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=56.72  E-value=6.7  Score=23.70  Aligned_cols=17  Identities=18%  Similarity=0.204  Sum_probs=13.3

Q ss_pred             EEEEEE---ccccccccccC
Q 041240           59 LQKVEY---EGLPNTSFLCG   75 (113)
Q Consensus        59 ~~~v~Y---E~Lp~fC~~Cg   75 (113)
                      +|+|+.   .++..||..||
T Consensus         7 yY~v~~~kv~rk~~~CPrCG   26 (51)
T COG1998           7 YYEVDDEKVKRKNRFCPRCG   26 (51)
T ss_pred             EEEEcCCcEEEccccCCCCC
Confidence            566666   56788999999


No 30 
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]
Probab=56.16  E-value=14  Score=28.62  Aligned_cols=82  Identities=20%  Similarity=0.257  Sum_probs=53.6

Q ss_pred             ccccc-HHHHHHHhhccCceEEEecCCCcccccce-------eEEEEEecCCCCceeEEEEcCeEE-------------E
Q 041240            3 LHYYN-KKILRMLGQIFGRVFKTDYNTESASRDKF-------GRLAVEIDPNKPLISQFFLDGKLQ-------------K   61 (113)
Q Consensus         3 ~~y~~-~~~l~~I~~~iG~~l~vD~~t~~~~~g~f-------aRV~VeiDl~kpL~~~v~v~g~~~-------------~   61 (113)
                      +.+|+ .++...|...+|.|+.++.+......+..       .+..+-+.+..-+=..+.++|+.+             .
T Consensus        90 ~~~~~~~~l~~~L~~~~~~Pv~veNDan~aalaE~~~g~~~~~~~~~~i~~gtGIG~giv~~g~l~~G~~g~age~Gh~~  169 (314)
T COG1940          90 LGWWNGVDLAEELEARLGLPVFVENDANAAALAEAWFGAGRGIDDVVYITLGTGIGGGIIVNGKLLRGANGNAGEIGHMV  169 (314)
T ss_pred             CCccccccHHHHHHHHHCCCEEEecHHHHHHHHHHHhCCCCCCCCEEEEEEccceeEEEEECCEEeecCCCccccccceE
Confidence            34555 45788999999999999987764333222       223444556666666677776533             2


Q ss_pred             EEEccccccccccCccccCCCCCCCCC
Q 041240           62 VEYEGLPNTSFLCGKYGHSKDICPNRT   88 (113)
Q Consensus        62 v~YE~Lp~fC~~Cg~iGH~~~~C~~~~   88 (113)
                      +...+-   | .||..|+....+....
T Consensus       170 v~~~g~---c-~cG~~GclE~~as~~a  192 (314)
T COG1940         170 VDPDGE---C-GCGRRGCLETYASGRA  192 (314)
T ss_pred             ECCCCc---c-CCCCCCchHHhccHHH
Confidence            333333   9 9999999888777553


No 31 
>PRK09570 rpoH DNA-directed RNA polymerase subunit H; Reviewed
Probab=55.19  E-value=23  Score=23.19  Aligned_cols=41  Identities=20%  Similarity=0.261  Sum_probs=30.5

Q ss_pred             CCcccccHHHHHHHhhccCceEEEecCCCcccccceeEEEE
Q 041240            1 MALHYYNKKILRMLGQIFGRVFKTDYNTESASRDKFGRLAV   41 (113)
Q Consensus         1 LP~~y~~~~~l~~I~~~iG~~l~vD~~t~~~~~g~faRV~V   41 (113)
                      ||.-+-++-+.+.+|..-|.++++-..+......-+-|+.|
T Consensus        37 LP~I~~~DPv~r~~g~k~GdVvkI~R~S~taG~~v~YR~Vv   77 (79)
T PRK09570         37 LPKIKASDPVVKAIGAKPGDVIKIVRKSPTAGEAVYYRLVV   77 (79)
T ss_pred             CCceeccChhhhhcCCCCCCEEEEEECCCCCCccEEEEEEe
Confidence            67778888899999999999999998865443333344443


No 32 
>KOG2560 consensus RNA splicing factor - Slu7p [RNA processing and modification]
Probab=50.76  E-value=5.5  Score=34.17  Aligned_cols=20  Identities=25%  Similarity=0.443  Sum_probs=17.9

Q ss_pred             ccccccCccccCCCCCCCCC
Q 041240           69 NTSFLCGKYGHSKDICPNRT   88 (113)
Q Consensus        69 ~fC~~Cg~iGH~~~~C~~~~   88 (113)
                      .+|-+||-.||..+.|-...
T Consensus       113 GACeNCGAmtHk~KDCmERP  132 (529)
T KOG2560|consen  113 GACENCGAMTHKVKDCMERP  132 (529)
T ss_pred             hhhhhhhhhhcchHHHhhcc
Confidence            58999999999999998654


No 33 
>PF00567 TUDOR:  Tudor domain;  InterPro: IPR008191 There are multiple copies of this domain in the Drosophila melanogaster tudor protein and it has been identified in several RNA-binding proteins []. Although the function of this domain is unknown, in Drosophila melanogaster the tudor protein is required during oogenesis for the formation of primordial germ cells and for normal abdominal segmentation [].; PDB: 3NTI_A 3NTK_B 3NTH_A 2DIQ_A 3FDR_A 3PNW_O 3S6W_A 3PMT_A 2WAC_A 2O4X_A ....
Probab=45.50  E-value=37  Score=21.55  Aligned_cols=46  Identities=24%  Similarity=0.528  Sum_probs=30.2

Q ss_pred             ccceeEEEEEecCCCCceeEEEEc-CeEEEEE----------EccccccccccCccc
Q 041240           33 RDKFGRLAVEIDPNKPLISQFFLD-GKLQKVE----------YEGLPNTSFLCGKYG   78 (113)
Q Consensus        33 ~g~faRV~VeiDl~kpL~~~v~v~-g~~~~v~----------YE~Lp~fC~~Cg~iG   78 (113)
                      -+.|-|+.|..+.......-..|+ |....|.          +..+|..++.|.+-|
T Consensus        65 ~~~w~Ra~I~~~~~~~~~~V~~iD~G~~~~v~~~~l~~l~~~~~~~P~~a~~~~L~g  121 (121)
T PF00567_consen   65 DGRWYRAVITVDIDENQYKVFLIDYGNTEKVSASDLRPLPPEFASLPPQAIKCKLAG  121 (121)
T ss_dssp             TSEEEEEEEEEEECTTEEEEEETTTTEEEEEEGGGEEE--HHHCSSSSSCEEEEET-
T ss_pred             CCceeeEEEEEecccceeEEEEEecCceEEEcHHHhhhhCHHHhhCChhhEEEEEcC
Confidence            468999999667777666655555 5544343          455688888887655


No 34 
>COG5179 TAF1 Transcription initiation factor TFIID, subunit TAF1 [Transcription]
Probab=40.81  E-value=15  Score=33.16  Aligned_cols=25  Identities=36%  Similarity=0.705  Sum_probs=19.0

Q ss_pred             cccccccCccccCC--CCCCCCCcccc
Q 041240           68 PNTSFLCGKYGHSK--DICPNRTEEDH   92 (113)
Q Consensus        68 p~fC~~Cg~iGH~~--~~C~~~~~~~~   92 (113)
                      -..|.+||-+||..  +.||.-...+.
T Consensus       937 tr~C~nCGQvGHmkTNK~CP~f~s~~~  963 (968)
T COG5179         937 TRTCGNCGQVGHMKTNKACPKFSSKDN  963 (968)
T ss_pred             ceecccccccccccccccCccccCCCC
Confidence            45899999999976  47998655443


No 35 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=40.65  E-value=11  Score=22.01  Aligned_cols=18  Identities=28%  Similarity=0.458  Sum_probs=12.8

Q ss_pred             ccccccccCccccCCCCC
Q 041240           67 LPNTSFLCGKYGHSKDIC   84 (113)
Q Consensus        67 Lp~fC~~Cg~iGH~~~~C   84 (113)
                      -..||+.|+.--|....|
T Consensus        47 ~~~fC~~C~~~~H~~~~C   64 (64)
T PF01485_consen   47 GTEFCFKCGEPWHEGVTC   64 (64)
T ss_dssp             CSEECSSSTSESCTTS-H
T ss_pred             CCcCccccCcccCCCCCC
Confidence            356889999888876554


No 36 
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]
Probab=36.87  E-value=16  Score=31.68  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=17.2

Q ss_pred             cccccCccccCCCCCCCC
Q 041240           70 TSFLCGKYGHSKDICPNR   87 (113)
Q Consensus        70 fC~~Cg~iGH~~~~C~~~   87 (113)
                      .|+.||-+||....|+..
T Consensus       287 ~c~~cg~~gH~~~dc~~~  304 (554)
T KOG0119|consen  287 VCKICGPLGHISIDCKVN  304 (554)
T ss_pred             cccccCCcccccccCCCc
Confidence            899999999999999987


No 37 
>KOG2673 consensus Uncharacterized conserved protein, contains PSP domain [Function unknown]
Probab=33.72  E-value=22  Score=30.51  Aligned_cols=18  Identities=39%  Similarity=0.665  Sum_probs=16.7

Q ss_pred             ccccCccccCCCCCCCCC
Q 041240           71 SFLCGKYGHSKDICPNRT   88 (113)
Q Consensus        71 C~~Cg~iGH~~~~C~~~~   88 (113)
                      ||+||-.-|+..+|+...
T Consensus       131 CFNC~g~~hsLrdC~rp~  148 (485)
T KOG2673|consen  131 CFNCGGTPHSLRDCPRPF  148 (485)
T ss_pred             ccccCCCCCccccCCCcc
Confidence            799999999999999875


No 38 
>PF01188 MR_MLE:  Mandelate racemase / muconate lactonizing enzyme, C-terminal domain;  InterPro: IPR013342 Mandelate racemase 5.1.2.2 from EC (MR) and muconate lactonising enzyme 5.5.1.1 from EC (MLE) are two bacterial enzymes involved in aromatic acid catabolism. They catalyse mechanistically distinct reactions yet they are related at the level of their primary, quaternary (homooctamer) and tertiary structures [, ]. A number of other proteins also seem to be evolutionary related to these two enzymes. These include, various plasmid-encoded chloromuconate cycloisomerases 5.5.1.7 from EC, Escherichia coli protein rspA [], E. coli bifunctional DGOA protein, E. coli hypothetical proteins ycjG, yfaW and yidU and a hypothetical protein from Streptomyces ambofaciens []. This entry represents the C-terminal region of these proteins.; PDB: 3QLD_B 3CYJ_C 2QDD_B 3FVD_A 3H7V_A 2OZT_A 3NXL_A 1JDF_D 1JCT_B 1EC9_C ....
Probab=32.70  E-value=53  Score=19.76  Aligned_cols=24  Identities=21%  Similarity=-0.013  Sum_probs=20.0

Q ss_pred             CcccccHHHHHHHhhccCceEEEe
Q 041240            2 ALHYYNKKILRMLGQIFGRVFKTD   25 (113)
Q Consensus         2 P~~y~~~~~l~~I~~~iG~~l~vD   25 (113)
                      |+..++-..+..+...++.||.+|
T Consensus        44 P~~~~d~~~~~~l~~~~~~pia~d   67 (67)
T PF01188_consen   44 PLPPDDLDGLAELRQQTSVPIAAD   67 (67)
T ss_dssp             SSSTTSHHHHHHHHHHCSSEEEES
T ss_pred             CCCCCCHHHHHHHHHhCCCCEEeC
Confidence            566677788999999999999876


No 39 
>KOG2985 consensus Uncharacterized conserved protein [Function unknown]
Probab=30.96  E-value=11  Score=30.06  Aligned_cols=29  Identities=24%  Similarity=0.363  Sum_probs=22.4

Q ss_pred             ccccccccccCccccCCCCCCCCCccccc
Q 041240           65 EGLPNTSFLCGKYGHSKDICPNRTEEDHA   93 (113)
Q Consensus        65 E~Lp~fC~~Cg~iGH~~~~C~~~~~~~~~   93 (113)
                      |....-|..||..||..-+|.+-...+.+
T Consensus        78 ~arsg~ckRcg~~ghl~fqcRn~~~vke~  106 (306)
T KOG2985|consen   78 EARSGSCKRCGRVGHLTFQCRNFLSVKED  106 (306)
T ss_pred             hhcccchhhccccchhhHHHhhhhhcccc
Confidence            44456799999999999999977544443


No 40 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=30.02  E-value=24  Score=21.67  Aligned_cols=15  Identities=13%  Similarity=0.235  Sum_probs=12.0

Q ss_pred             EEEccccccccccCc
Q 041240           62 VEYEGLPNTSFLCGK   76 (113)
Q Consensus        62 v~YE~Lp~fC~~Cg~   76 (113)
                      -+-+.+|.||..|..
T Consensus        22 T~LkNfPlyCpKCK~   36 (55)
T PF14205_consen   22 TVLKNFPLYCPKCKQ   36 (55)
T ss_pred             ceeccccccCCCCCc
Confidence            346789999999975


No 41 
>PF05515 Viral_NABP:  Viral nucleic acid binding ;  InterPro: IPR008891 This family is common to ssRNA positive-strand viruses and are commonly described as nucleic acid binding proteins (NABP).
Probab=29.97  E-value=32  Score=24.44  Aligned_cols=19  Identities=37%  Similarity=0.859  Sum_probs=16.4

Q ss_pred             ccccccCccccCCCCCCCC
Q 041240           69 NTSFLCGKYGHSKDICPNR   87 (113)
Q Consensus        69 ~fC~~Cg~iGH~~~~C~~~   87 (113)
                      ..|+.||.+=|....|+..
T Consensus        63 ~~C~~CG~~l~~~~~C~~~   81 (124)
T PF05515_consen   63 NRCFKCGRYLHNNGNCRRN   81 (124)
T ss_pred             CccccccceeecCCcCCCc
Confidence            4799999999988899954


No 42 
>KOG4399 consensus C2HC-type Zn-finger protein [General function prediction only]
Probab=29.92  E-value=25  Score=28.35  Aligned_cols=20  Identities=35%  Similarity=0.966  Sum_probs=18.0

Q ss_pred             cccccccCccccCCCCCCCC
Q 041240           68 PNTSFLCGKYGHSKDICPNR   87 (113)
Q Consensus        68 p~fC~~Cg~iGH~~~~C~~~   87 (113)
                      -.||+.||.+-|....|+.-
T Consensus       261 ~~~C~iC~~~~~~R~~C~~~  280 (325)
T KOG4399|consen  261 KHGCFICGELDHKRSTCPNI  280 (325)
T ss_pred             hcceeeccccccccccCccH
Confidence            46999999999999999975


No 43 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=28.82  E-value=20  Score=18.16  Aligned_cols=9  Identities=22%  Similarity=0.368  Sum_probs=6.7

Q ss_pred             cccccccCc
Q 041240           68 PNTSFLCGK   76 (113)
Q Consensus        68 p~fC~~Cg~   76 (113)
                      -.||.+||.
T Consensus        16 ~~fC~~CG~   24 (26)
T PF13248_consen   16 AKFCPNCGA   24 (26)
T ss_pred             cccChhhCC
Confidence            468888874


No 44 
>PRK09698 D-allose kinase; Provisional
Probab=27.98  E-value=1.1e+02  Score=23.47  Aligned_cols=78  Identities=9%  Similarity=0.085  Sum_probs=44.4

Q ss_pred             HHHHHHHhhccCceEEEecCCCccccccee------EEEEEecCCCCceeEEEEcCeEE-----------EEEEcccccc
Q 041240            8 KKILRMLGQIFGRVFKTDYNTESASRDKFG------RLAVEIDPNKPLISQFFLDGKLQ-----------KVEYEGLPNT   70 (113)
Q Consensus         8 ~~~l~~I~~~iG~~l~vD~~t~~~~~g~fa------RV~VeiDl~kpL~~~v~v~g~~~-----------~v~YE~Lp~f   70 (113)
                      -.+.+.+.+.+|.|+.++.+......+.+.      +-.+-+.+..=+=..+.++|+.+           .+-+..-...
T Consensus        94 ~~l~~~l~~~~~~pv~v~NDa~aaa~~E~~~~~~~~~~~~~v~lgtGIG~giv~~G~~~~G~~g~agEiGh~~v~~~~~~  173 (302)
T PRK09698         94 YDLADKLENTLNCPVFFSRDVNLQLLWDVKENNLTQQLVLGAYLGTGMGFAVWMNGAPWTGAHGVAGELGHIPLGDMTQH  173 (302)
T ss_pred             CCHHHHHHHHhCCCEEEcchHhHHHHHHHHhcCCCCceEEEEEecCceEEEEEECCEEeeCCCCCccccCceEeeCCCcc
Confidence            356677888999999999876654433221      12233344444444555665432           1222222346


Q ss_pred             ccccCccccCCCCCCC
Q 041240           71 SFLCGKYGHSKDICPN   86 (113)
Q Consensus        71 C~~Cg~iGH~~~~C~~   86 (113)
                      |. ||..|+....|..
T Consensus       174 C~-CG~~gclE~~~S~  188 (302)
T PRK09698        174 CG-CGNPGCLETNCSG  188 (302)
T ss_pred             cC-CCCccchHhhcCH
Confidence            64 8888888777753


No 45 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=27.59  E-value=26  Score=18.40  Aligned_cols=13  Identities=15%  Similarity=0.110  Sum_probs=6.8

Q ss_pred             cccccccCccccC
Q 041240           68 PNTSFLCGKYGHS   80 (113)
Q Consensus        68 p~fC~~Cg~iGH~   80 (113)
                      +.||..||-.-+.
T Consensus         3 ~rfC~~CG~~t~~   15 (32)
T PF09297_consen    3 HRFCGRCGAPTKP   15 (32)
T ss_dssp             TSB-TTT--BEEE
T ss_pred             CcccCcCCccccC
Confidence            5789999865443


No 46 
>PF10741 T2SM_b:  Type II secretion system (T2SS), protein M subtype b;  InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria. It consists of a short cytosolic N-terminal domain, a transmembrane domain, and a C-terminal periplasmic domain. The precise function of this protein is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers [],; GO: 0006858 extracellular transport
Probab=26.55  E-value=1.2e+02  Score=20.14  Aligned_cols=42  Identities=17%  Similarity=0.199  Sum_probs=31.6

Q ss_pred             HHHHHHhhccCceEEEecCCCcccccceeEEEEEecCCCCce
Q 041240            9 KILRMLGQIFGRVFKTDYNTESASRDKFGRLAVEIDPNKPLI   50 (113)
Q Consensus         9 ~~l~~I~~~iG~~l~vD~~t~~~~~g~faRV~VeiDl~kpL~   50 (113)
                      +.++++++.-|-.+...........+.|-||.|.++++-++.
T Consensus        20 ~~l~~~v~~aG~~v~s~q~~p~~~~~~~~~i~v~~~~~g~~~   61 (110)
T PF10741_consen   20 QRLRALVAAAGGQVSSSQVLPPRPDGNFRRISVRVSLEGDIE   61 (110)
T ss_pred             HHHHHHHHHcCCEEEEEEecCCCCCCcceEEEEEEEEEeCHH
Confidence            346777777787777776666777888999999988776653


No 47 
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=25.92  E-value=41  Score=20.84  Aligned_cols=20  Identities=25%  Similarity=0.454  Sum_probs=9.5

Q ss_pred             eEEEEEEccccccccccCcc
Q 041240           58 KLQKVEYEGLPNTSFLCGKY   77 (113)
Q Consensus        58 ~~~~v~YE~Lp~fC~~Cg~i   77 (113)
                      ..-.+.|-.|-..|.+||.+
T Consensus        38 ~~s~v~fH~lg~KC~~C~SY   57 (61)
T PF14599_consen   38 AKSEVPFHFLGHKCSHCGSY   57 (61)
T ss_dssp             -EEEEE--TT----TTTS--
T ss_pred             CccceeeeHhhhcCCCCCCc
Confidence            35589999999999999976


No 48 
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=25.43  E-value=40  Score=20.32  Aligned_cols=25  Identities=36%  Similarity=0.635  Sum_probs=16.6

Q ss_pred             ccccccccCccccCC----CCCCCCCccc
Q 041240           67 LPNTSFLCGKYGHSK----DICPNRTEED   91 (113)
Q Consensus        67 Lp~fC~~Cg~iGH~~----~~C~~~~~~~   91 (113)
                      -..+|+-||.-=-..    +.||-....+
T Consensus        26 ~~~YC~~Cg~~Y~d~~dL~~~CPG~t~~d   54 (55)
T PF13821_consen   26 EHNYCFWCGTKYDDEEDLERNCPGPTEDD   54 (55)
T ss_pred             hCceeeeeCCccCCHHHHHhCCCCCCccc
Confidence            367999999854444    5687665443


No 49 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=25.13  E-value=29  Score=20.47  Aligned_cols=11  Identities=18%  Similarity=0.111  Sum_probs=8.3

Q ss_pred             ccccccccCcc
Q 041240           67 LPNTSFLCGKY   77 (113)
Q Consensus        67 Lp~fC~~Cg~i   77 (113)
                      --.+|.+||+|
T Consensus        45 ~i~~Cp~CgRi   55 (56)
T PF02591_consen   45 EIVFCPNCGRI   55 (56)
T ss_pred             CeEECcCCCcc
Confidence            35689999875


No 50 
>smart00769 WHy Water Stress and Hypersensitive response.
Probab=24.14  E-value=93  Score=20.15  Aligned_cols=33  Identities=9%  Similarity=0.092  Sum_probs=27.2

Q ss_pred             ceeEEEEEecCCCCceeEEEEcCeEEEEEEccc
Q 041240           35 KFGRLAVEIDPNKPLISQFFLDGKLQKVEYEGL   67 (113)
Q Consensus        35 ~faRV~VeiDl~kpL~~~v~v~g~~~~v~YE~L   67 (113)
                      .=+++.+.+.+..|-...+.+++..|.+.|.+.
T Consensus        13 ~~~~~~l~l~v~NPN~~~l~~~~~~y~l~~~g~   45 (100)
T smart00769       13 LEIEIVLKVKVQNPNPFPIPVNGLSYDLYLNGV   45 (100)
T ss_pred             eEEEEEEEEEEECCCCCccccccEEEEEEECCE
Confidence            346778888899999988889888888888764


No 51 
>PRK15329 chaperone protein SicP; Provisional
Probab=23.98  E-value=71  Score=23.09  Aligned_cols=22  Identities=27%  Similarity=0.372  Sum_probs=19.4

Q ss_pred             HHHHHHHhhccCceEEEecCCC
Q 041240            8 KKILRMLGQIFGRVFKTDYNTE   29 (113)
Q Consensus         8 ~~~l~~I~~~iG~~l~vD~~t~   29 (113)
                      .+.|.++|++.|-||..|.+..
T Consensus         5 ~~lL~~~~~~lGLpL~fDd~gq   26 (138)
T PRK15329          5 TEWLAALGEALGLPLTFDDNGQ   26 (138)
T ss_pred             HHHHHHHHHHhCCceEEcCCCc
Confidence            5789999999999999998753


No 52 
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=23.39  E-value=40  Score=28.16  Aligned_cols=39  Identities=23%  Similarity=0.255  Sum_probs=22.1

Q ss_pred             ccccHHHHHHHhhcc-------CceEEEecCCCcccccceeEEEEEecC
Q 041240            4 HYYNKKILRMLGQIF-------GRVFKTDYNTESASRDKFGRLAVEIDP   45 (113)
Q Consensus         4 ~y~~~~~l~~I~~~i-------G~~l~vD~~t~~~~~g~faRV~VeiDl   45 (113)
                      +|.+|-.|+.|-+.|       ++-++-=   .+....||.||.|+++=
T Consensus       180 ~~~hE~glR~Lig~vaR~AAkyd~~i~Pl---ls~~~dhY~Rvfv~v~r  225 (380)
T COG1867         180 EFCHEVGLRILIGYVARTAAKYDKAIEPL---LSLSIDHYVRVFVEVRR  225 (380)
T ss_pred             cchhHHHHHHHHHHHHHHHHhhcccceeE---EEeeeceEEEEEEEEcc
Confidence            456666666554433       3322222   23456799999998753


No 53 
>KOG3794 consensus CBF1-interacting corepressor CIR and related proteins [Transcription]
Probab=22.59  E-value=40  Score=28.58  Aligned_cols=22  Identities=27%  Similarity=0.541  Sum_probs=17.8

Q ss_pred             cccccccCccccCC--CCCCCCCc
Q 041240           68 PNTSFLCGKYGHSK--DICPNRTE   89 (113)
Q Consensus        68 p~fC~~Cg~iGH~~--~~C~~~~~   89 (113)
                      ...|-.|+.+||..  ++||....
T Consensus       124 NVrC~kChkwGH~n~DreCplf~~  147 (453)
T KOG3794|consen  124 NVRCLKCHKWGHINTDRECPLFGK  147 (453)
T ss_pred             eeeEEeecccccccCCccCcchhh
Confidence            56899999999975  58997643


No 54 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=22.59  E-value=33  Score=18.76  Aligned_cols=8  Identities=25%  Similarity=0.430  Sum_probs=3.0

Q ss_pred             ccccccCc
Q 041240           69 NTSFLCGK   76 (113)
Q Consensus        69 ~fC~~Cg~   76 (113)
                      .||..||.
T Consensus         1 kfC~~CG~    8 (34)
T PF14803_consen    1 KFCPQCGG    8 (34)
T ss_dssp             -B-TTT--
T ss_pred             CccccccC
Confidence            36777764


No 55 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=22.23  E-value=2.5e+02  Score=19.18  Aligned_cols=26  Identities=19%  Similarity=0.323  Sum_probs=15.8

Q ss_pred             EcCeEEEEEEccccccccccCccccCCCCCC
Q 041240           55 LDGKLQKVEYEGLPNTSFLCGKYGHSKDICP   85 (113)
Q Consensus        55 v~g~~~~v~YE~Lp~fC~~Cg~iGH~~~~C~   85 (113)
                      +++....|+-++-.. |..|.    ....|.
T Consensus         4 v~~~~~~V~~~r~sa-C~~C~----~~~~Cg   29 (135)
T PF04246_consen    4 VEGGIAWVEVQRSSA-CGSCS----ASGGCG   29 (135)
T ss_pred             EeCCEEEEEEccCCc-CcccC----CCCCCC
Confidence            445555566554444 99997    445677


No 56 
>PF05037 DUF669:  Protein of unknown function (DUF669);  InterPro: IPR007731 This entry is represented by Streptococcus phage Sfi11, Gp151. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=21.33  E-value=51  Score=23.06  Aligned_cols=39  Identities=23%  Similarity=0.219  Sum_probs=27.6

Q ss_pred             ccHHHHHHHhhccCceEEEecCCCc----ccccceeEEEEEec
Q 041240            6 YNKKILRMLGQIFGRVFKTDYNTES----ASRDKFGRLAVEID   44 (113)
Q Consensus         6 ~~~~~l~~I~~~iG~~l~vD~~t~~----~~~g~faRV~VeiD   44 (113)
                      |+.+.|..|+.++|.|-..|..+..    ...|+.+||.|..+
T Consensus        71 ~~~~~l~~i~~a~G~~~~~~~~sl~~~~~~l~gk~l~V~v~~~  113 (141)
T PF05037_consen   71 YSIKRLNAIAKAAGIPEGTDFESLEQFLNQLLGKPLRVTVKWE  113 (141)
T ss_pred             hhHHHHHHHHHHhCCCCCCCcccHHHHHHHHcCCeeEEEeccc
Confidence            5667788999999977766665532    44577777777665


No 57 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=20.09  E-value=60  Score=19.14  Aligned_cols=11  Identities=18%  Similarity=0.211  Sum_probs=8.7

Q ss_pred             cccccccccCc
Q 041240           66 GLPNTSFLCGK   76 (113)
Q Consensus        66 ~Lp~fC~~Cg~   76 (113)
                      .+..||..||.
T Consensus        18 ~~~~fCP~Cg~   28 (50)
T PRK00432         18 RKNKFCPRCGS   28 (50)
T ss_pred             EccCcCcCCCc
Confidence            45679999986


No 58 
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism.  A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+.  For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions.  
Probab=20.06  E-value=1.5e+02  Score=19.32  Aligned_cols=15  Identities=20%  Similarity=0.084  Sum_probs=12.4

Q ss_pred             ccccccccCccccCC
Q 041240           67 LPNTSFLCGKYGHSK   81 (113)
Q Consensus        67 Lp~fC~~Cg~iGH~~   81 (113)
                      .+.+|..||.+-+..
T Consensus        72 ~H~~C~~Cg~i~~~~   86 (116)
T cd07153          72 HHLICTKCGKVIDFE   86 (116)
T ss_pred             CceEeCCCCCEEEec
Confidence            468999999998864


Done!