Citrus Sinensis ID: 041242

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
MAGGGAAAGAAAAGDRSLRDTPTWAVALVCAVLLILSILIEHGIHSLSKWFQKRQKKAMSEALEKIKAELMLLGFLSLLLTVGTRFIYKICIPAEYGNTMLPCKIENDTGGDDDDHRRKLLLYSGDVMWRRVLAAPAGGDDYCSRKGQVSLISLTGLHQLHIFIFVLAVFHVLYSVITIALAKAKMKKWQAWELETNSLEYQFTNDPARFRFTHQTSFVKRHSGLSRTPGIRWIVAFFRQFFGSVSKVDYMTMRHGFINAHFAPNTSFDFHKYIKRSLEDDFKVVVGISIPLWIVAVIFLLVNVYKWDSLSWLTIILLVGTKLELVIMEMAQEIQDRTTVVRGAPVVEPNNKFFWFNRPEWILFLIHYTLFQNAFQMAFFLWIVYEFGIHSCFHENLPLILTRVIVGVALQFLCSYITFPLYALVTQMGSHMKKSIFEEQTAKALKKWQKAAKERRRSRNKAAAGADKCSGFLSGENTPSQGASPIHLLHHYKYRSNQQDIESVRSYQSDNELSEIEPSSTHHHHQDQGRDEDLHNSDFSFVKL
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*******************DTPTWAVALVCAVLLILSILIEHGIHSLSKWFQKRQKKAMSEALEKIKAELMLLGFLSLLLTVGTRFIYKICIPAEYGNTMLPCKIE***********RKLLLYSGDVMWRRVLAAPAGGDDYCSRKGQVSLISLTGLHQLHIFIFVLAVFHVLYSVITIALAKAKMKKWQAWELETNSLEYQFTNDPARFRFTHQTSFVKRHSGLSRTPGIRWIVAFFRQFFGSVSKVDYMTMRHGFINAHFAPNTSFDFHKYIKRSLEDDFKVVVGISIPLWIVAVIFLLVNVYKWDSLSWLTIILLVGTKLELVIMEMAQEIQDRTTVVRGAPVVEPNNKFFWFNRPEWILFLIHYTLFQNAFQMAFFLWIVYEFGIHSCFHENLPLILTRVIVGVALQFLCSYITFPLYALVTQMGSHMKK*****QTAKAL**********************************************************************************************SFVKL
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGGGAAAGAAAAGDRSLRDTPTWAVALVCAVLLILSILIEHGIHSLSKWFQKRQKKAMSEALEKIKAELMLLGFLSLLLTVGTRFIYKICIPAEYGNTMLPCKIENDTGGDDDDHRRKLLLYSGDVMWRRVLAAPAGGDDYCSRKGQVSLISLTGLHQLHIFIFVLAVFHVLYSVITIALAKAKMKKWQAWELETNSLEYQFTNDPARFRFTHQTSFVKRHSGLSRTPGIRWIVAFFRQFFGSVSKVDYMTMRHGFINAHFAPNTSFDFHKYIKRSLEDDFKVVVGISIPLWIVAVIFLLVNVYKWDSLSWLTIILLVGTKLELVIMEMAQEIQDRTTVVRGAPVVEPNNKFFWFNRPEWILFLIHYTLFQNAFQMAFFLWIVYEFGIHSCFHENLPLILTRVIVGVALQFLCSYITFPLYALVTQMGSHMKKSIFEEQTAKALKKWQKAAKERRRSRNKAAAGADKCSGFLSGENTPSQGASPIHLLHHYKYRSNQQDIESVRSYQSDNELSEIEPSSTHHHHQDQGRDEDLHNSDFSFVKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MLO protein homolog 1 May be involved in modulation of pathogen defense and leaf cell death. Activity seems to be regulated by Ca(2+)-dependent calmodulin binding and seems not to require heterotrimeric G proteins.probableA2YD22
Protein MLO Seems to be involved in modulation of pathogen defense and leaf cell death. Down-regulates broad spectrum resistance to powdery mildew fungus and its defense suppression activity is enhanced by Ca(2+)-dependent calmodulin binding. Signaling seems not to require heterotrimeric G proteins.probableP93766
MLO protein homolog 1 May be involved in modulation of pathogen defense and leaf cell death. Activity seems to be regulated by Ca(2+)-dependent calmodulin binding and seems not to require heterotrimeric G proteins.probableO49873

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted