Citrus Sinensis ID: 041249

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79
ILALDSNRLSGNIPPSIGNLKKLVEPYVSDNFLKGSIPSSLGLCESLTTIGLFNNNLSGTIPPQLMGLTSLVALDLSRNQFRGSFPTEVGNLINLETLTVSGNILQGEIPSTLGSCIKLEILEMQGNVFQGLTILDLSRNKLSGEIPEFLVGLKVIENLNLSYNDLEGMVPTEGVFKNASAISVLGNNKLCGGISEFKLPPCGLKKSTEWRLTFELKLVIAIVSGLMGLALTLSISFLCWVRKRKEQSNPNSLINSLLNLSYQNLHNATDGFSSANLIGTGSFGSVYKGVLDEGRTTVTVKVFNLHHHRASRSFIAECRALRSIRHRNLVKVFTACSGVDYQGNDFKALVYEFMQNGSLEEWLYPVNREDEVDKAPRNLNLLQRLNIAIDVASALDYLHHDCQPITTHCDLKPSNILLDEEMVSHVGDFGLARFLPPTHVQTSSIGVKGSIGYIAPEYGLGSEVSTNGDVYSYGILMLELIIRKKPSDIMFEGDMNLHNFARMALPDHVMDIVDSTLLNDVEDLAIISNQRQRQIRVNNIIECLISMLRIGSKAQKVTILDLESLKLAGSILPHIGNLSFLKILNLENNSFTHEIPSEIGRLRRLQVPDLNNNSIGGEIPVNLSSCSNLIRIGLAKNQLMGKIPSDFGSLSKIEVLSLGFNNLIGSIPPPLGNLSSLRKISLAINNLAGSIPFTLSKLKNLVILYLGVNRLSGIVPSSIFNISSIAEFDVGENKIQGNIPLDYGFTLQNLQYFSIGTNRITGAIPPSISNASKLEVFQALNNKLTGEVP
cCECcccccECccccccccccccccEEcccccccccccccccccccccEEEccccccccccccHHHccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHHHccccccEEEccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccEEEcccccEEEEEECccccEEEEEEEcccccccccHHHHHHHHHHHcccccccccEEEEcccccccccCEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccECccccccccccccccCEEccccHHHHcccccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHcccccccccEEcccccccccccccccccccccEEEccccccccccccHcccccccccccccccEEccccccccccccccccEEcccccccccccHHHHccccccEEECccccccccccHHHHcccccccccccccccccccccccHHccccccEEEccccccccccc
ILALDSNRLSGNIPPSIGNLKKLVEPYVSDNFLKGSIPSSLGLCESLTTIGLFNNNLSGTIPPQLMGLTSLVALDLSRNQFRGSFPTEVGNLINLETLTVSGNILQGEIPSTLGSCIKLEILEMQGNVFQGLTILDLSRNKLSGEIPEFLVGLKVIENLNLSYNDLEGMVPTEGVFKNASAISVLGNNKLCGGISEFKLPPCGLKKSTEWRLTFELKLVIAIVSGLMGLALTLSISFLCWVRKR*******SLINSLLNLSYQNLHNATDGFSSANLIGTGSFGSVYKGVLDEGRTTVTVKVFNLHHHRASRSFIAECRALRSIRHRNLVKVFTACSGVDYQGNDFKALVYEFMQNGSLEEWLYPVNR*****KAPRNLNLLQRLNIAIDVASALDYLHHDCQPITTHCDLKPSNILLDEEMVSHVGDFGLARFLPPTHVQTSSIGVKGSIGYIAPEYGLGSEVSTNGDVYSYGILMLELIIRKKPSDIMFEGDMNLHNFARMALPDHVMDIVDSTLLNDVEDLAIISNQRQRQIRVNNIIECLISMLRIGSKAQKVTILDLESLKLAGSILPHIGNLSFLKILNLENNSFTHEIPSEIGRLRRLQVPDLNNNSIGGEIPVNLSSCSNLIRIGLAKNQLMGKIPSDFGSLSKIEVLSLGFNNLIGSIPPPLGNLSSLRKISLAINNLAGSIPFTLSKLKNLVILYLGVNRLSGIVPSSIFNISSIAEFDVGENKIQGNIPLDYGFTLQNLQYFSIGTNRITGAIPPSISNASKLEVFQALNNKLTGEVP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILALDSNRLSGNIPPSIGNLKKLVEPYVSDNFLKGSIPSSLGLCESLTTIGLFNNNLSGTIPPQLMGLTSLVALDLSRNQFRGSFPTEVGNLINLETLTVSGNILQGEIPSTLGSCIKLEILEMQGNVFQGLTILDLSRNKLSGEIPEFLVGLKVIENLNLSYNDLEGMVPTEGVFKNASAISVLGNNKLCGGISEFKLPPCGLKKSTEWRLTFELKLVIAIVSGLMGLALTLSISFLCWVRKRKEQSNPNSLINSLLNLSYQNLHNATDGFSSANLIGTGSFGSVYKGVLDEGRTTVTVKVFNLHHHRASRSFIAECRALRSIRHRNLVKVFTACSGVDYQGNDFKALVYEFMQNGSLEEWLYPVNREDEVDKAPRNLNLLQRLNIAIDVASALDYLHHDCQPITTHCDLKPSNILLDEEMVSHVGDFGLARFLPPTHVQTSSIGVKGSIGYIAPEYGLGSEVSTNGDVYSYGILMLELIIRKKPSDIMFEGDMNLHNFARMALPDHVMDIVDSTLLNDVEDLAIISNQRQRQIRVNNIIECLISMLRIGSKAQKVTILDLESLKLAGSILPHIGNLSFLKILNLENNSFTHEIPSEIGRLRRLQVPDLNNNSIGGEIPVNLSSCSNLIRIGLAKNQLMGKIPSDFGSLSKIEVLSLGFNNLIGSIPPPLGNLSSLRKISLAINNLAGSIPFTLSKLKNLVILYLGVNRLSGIVPSSIFNISSIAEFDVGENKIQGNIPLDYGFTLQNLQYFSIGTNRITGAIPPSISNASKLEVFQALNNKLTGEVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 1-197,262-264,321-366,378-379,393-399,426-430,447,482-486,549-789
View the alignment between query and template
View the model in PyMOL
Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 2-190,315-340,356-362,391-415,426-428,454-468,511-518,546-789
View the alignment between query and template
View the model in PyMOL
Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 2-203,299-309,379-402,423-432,449-456,487,517,548-788
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 256-521,540-572
View the alignment between query and template
View the model in PyMOL
Template: 3QYZ, chain A
Confidence level:very confident
Coverage over the Query: 269-365,377-572
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:confident
Coverage over the Query: 557-781
View the alignment between query and template
View the model in PyMOL