Citrus Sinensis ID: 041263


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MSEKAQHGPVYFELNTGAKIPSVGLGTWKAPPGEVGEAVIAAVKAGYRHIDCAHVYDNEKEVGAALKQFFSTGVVKRDEMFITSKIWCCDLAPEDVPKALSRSLEHLQLDYIDLYLIHWPFRTKPETRGFEPDIMLPLCLPETWAAMEKLYDSGKARAIGVSNFSTKKLKDLCSYAKVKPAVNQVECHPVWQQPALHEYCKSSGVHLTAYSPLGSPGSWVKGEILKEAILQEIAGELNKSPAQVALRWGLQSGHSILPKSVNESRIKENFNLFDWSIPPKLFSRFSNIHQQRLLRGTFAVHETRSPYKSLEELWDGEI
ccccccccccEEEcccccccccccEEccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccEEEEccccccccccccHHHHHHHHHHHHccccccccEECcccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEECcccccHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccccccccccccccc
*********VYFELNTGAKIPSVGLGTWKAPPGEVGEAVIAAVKAGYRHIDCAHVYDNEKEVGAALKQFFSTGVVKRDEMFITSKIWCCDLAPEDVPKALSRSLEHLQLDYIDLYLIHWPFRTKPETRGFEPDIMLPLCLPETWAAMEKLYDSGKARAIGVSNFSTKKLKDLCSYAKVKPAVNQVECHPVWQQPALHEYCKSSGVHLTAYSPLGSPGSWVKGEILKEAILQEIAGELNKSPAQVALRWGLQSGHSILPKSVNESRIKENFNLFDWSIPPKLFSRFSNIHQQRLLRGTFAVHETRSPYKSLEELWDGEI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEKAQHGPVYFELNTGAKIPSVGLGTWKAPPGEVGEAVIAAVKAGYRHIDCAHVYDNEKEVGAALKQFFSTGVVKRDEMFITSKIWCCDLAPEDVPKALSRSLEHLQLDYIDLYLIHWPFRTKPETRGFEPDIMLPLCLPETWAAMEKLYDSGKARAIGVSNFSTKKLKDLCSYAKVKPAVNQVECHPVWQQPALHEYCKSSGVHLTAYSPLGSPGSWVKGEILKEAILQEIAGELNKSPAQVALRWGLQSGHSILPKSVNESRIKENFNLFDWSIPPKLFSRFSNIHQQRLLRGTFAVHETRSPYKSLEELWDGEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aldo-keto reductase family 4 member C9 Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids. May function as detoxifiying enzyme by reducing a range of toxic aldehydes and ketones produced during stress.probableQ0PGJ6
Alcohol dehydrogenase [NADP(+)] A Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs.probableQ6AZW2
Alcohol dehydrogenase [NADP(+)] Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs.probableQ5R5D5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable
1.1.1.2Alcohol dehydrogenase (NADP(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H7U, chain A
Confidence level:very confident
Coverage over the Query: 9-318
View the alignment between query and template
View the model in PyMOL