BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041278
         (101 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9LW86|SUT34_ARATH Probable sulfate transporter 3.4 OS=Arabidopsis thaliana
           GN=SULTR3;4 PE=2 SV=1
          Length = 653

 Score = 33.5 bits (75), Expect = 0.40,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 18/38 (47%)

Query: 43  WIWELTAFATKLIAIILAIEHASIRDWTMLWIECDSPL 80
           W WE        ++I+L   H S+R   + WI   SPL
Sbjct: 250 WSWETIVMGIGFLSILLTTRHISMRKPKLFWISAASPL 287


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.335    0.142    0.509 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,057,416
Number of Sequences: 539616
Number of extensions: 1066491
Number of successful extensions: 3676
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 3675
Number of HSP's gapped (non-prelim): 3
length of query: 101
length of database: 191,569,459
effective HSP length: 70
effective length of query: 31
effective length of database: 153,796,339
effective search space: 4767686509
effective search space used: 4767686509
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 55 (25.8 bits)