Citrus Sinensis ID: 041305

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MAKSDVKVLGFSPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKWFSALRDIGSANGAEAKKAAIEQLIEVLVLLEDAFVKCSKGKAFFGGNQIGFLDIAFGSYLGWLRVTEKMNEVKLLDEVKTPGLFKWAERFCADAAVKDVMPETDKLAELKASAPPSS
cccccEEEEcccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHccccccccEEEEccEEEccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccHHcccccHHHHHHHHHcccccc
**KSDVKVLGFSPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKWFSALRDIGSANGAEAKKAAIEQLIEVLVLLEDAFVKCSKGKAFFGGNQIGFLDIAFGSYLGWLRVTEKMNEVKLLDEVKTPGLFKWAERFCADAAVKDVMPETDKLAELKASAP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSDVKVLGFSPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKWFSALRDIGSANGAEAKKAAIEQLIEVLVLLEDAFVKCSKGKAFFGGNQIGFLDIAFGSYLGWLRVTEKMNEVKLLDEVKTPGLFKWAERFCADAAVKDVMPETDKLAELKASAPPSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutathione S-transferase U17 Involved in light signaling, mainly phyA-mediated photomorphogenesis and in the integration of various phytohormone signals to modulate various aspects of plant development by affecting glutathione pools. In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC).confidentQ9FUS8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GWC, chain A
Confidence level:very confident
Coverage over the Query: 4-221
View the alignment between query and template
View the model in PyMOL