Citrus Sinensis ID: 041342


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MAHNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLKGFDVYVNMVLEDVTEYEITAEGRRITKLDQILLNGNNIAILVPGGSPDPE
ccccccccccHHHHHHHcccEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEccccEEEEEEccEEEEcccEEEEEcccccccc
******Q**PSELIDRCIGSKIWVIMKGDKELVGTLKGFDVYVNMVLEDVTEYEITAEGRRITKLDQILLNGNNIAILV*G******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLKGFDVYVNMVLEDVTEYEITAEGRRITKLDQILLNGNNIAILVPGGSPDPE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U6 snRNA-associated Sm-like protein LSm5 Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.confidentQ2HJH0
U6 snRNA-associated Sm-like protein LSm5 Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.confidentQ5R628
U6 snRNA-associated Sm-like protein LSm5 Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.confidentQ9Y4Y9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FWK, chain A
Confidence level:very confident
Coverage over the Query: 6-84
View the alignment between query and template
View the model in PyMOL