Query         041400
Match_columns 95
No_of_seqs    104 out of 209
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 06:42:05 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041400.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041400hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02704 GASA:  Gibberellin reg 100.0 9.2E-38   2E-42  201.2   5.1   60   36-95      1-60  (60)
  2 PF07172 GRP:  Glycine rich pro  95.0   0.033 7.1E-07   38.2   3.4   20    1-20      1-20  (95)
  3 PF10731 Anophelin:  Thrombin i  84.2     1.5 3.2E-05   29.0   3.2   25    1-27      1-25  (65)
  4 PF07127 Nodulin_late:  Late no  83.3     1.1 2.4E-05   27.3   2.2   39    1-40      1-39  (54)
  5 PF10717 ODV-E18:  Occlusion-de  74.7       4 8.7E-05   28.2   3.0   24    6-29     29-52  (85)
  6 PF09257 BCMA-Tall_bind:  BCMA,  65.7     5.7 0.00012   23.9   2.0   21   40-60     16-36  (39)
  7 PLN03207 stomagen; Provisional  56.7      20 0.00044   25.9   3.8    6   41-46     84-89  (113)
  8 COG2991 Uncharacterized protei  56.3      13 0.00029   25.3   2.7   17    7-23      4-20  (77)
  9 PHA02637 TNF-alpha-receptor-li  49.8      16 0.00036   26.7   2.5   26   59-87     41-74  (127)
 10 PF10690 Myticin-prepro:  Mytic  48.4     9.4  0.0002   27.0   1.0   14   35-48     23-37  (98)
 11 PF11912 DUF3430:  Protein of u  45.3      17 0.00037   26.1   2.0   10    5-14      1-10  (212)
 12 PF12438 DUF3679:  Protein of u  41.0      39 0.00085   21.6   2.9   19    8-26      4-22  (56)
 13 PF07699 GCC2_GCC3:  GCC2 and G  38.9      39 0.00085   19.5   2.6   28   64-91     10-41  (48)
 14 PF08027 Albumin_I:  Albumin I;  38.6     7.5 0.00016   28.4  -0.7   12   63-74     37-48  (120)
 15 PF03058 Sar8_2:  Sar8.2 family  38.3      48   0.001   23.3   3.3   13    1-13      1-13  (93)
 16 PF13956 Ibs_toxin:  Toxin Ibs,  37.6      11 0.00025   19.5   0.1    9    6-14      3-11  (19)
 17 PF15240 Pro-rich:  Proline-ric  35.8      24 0.00051   27.2   1.6   15    8-22      3-17  (179)
 18 PRK09039 hypothetical protein;  31.5      61  0.0013   26.3   3.4   15    5-20     24-38  (343)
 19 PF10868 DUF2667:  Protein of u  30.4      22 0.00048   24.6   0.6   21   66-86     62-82  (90)
 20 PF01826 TIL:  Trypsin Inhibito  29.4     2.7 5.9E-05   24.8  -3.6   42   34-79      7-49  (55)
 21 PLN02995 Probable pectinestera  28.3 1.4E+02   0.003   26.2   5.1   16   41-56     37-52  (539)
 22 PRK00442 tatA twin arginine tr  27.2      60  0.0013   22.5   2.3   12    9-20     10-21  (92)
 23 PF09919 DUF2149:  Uncharacteri  27.0 1.1E+02  0.0023   20.9   3.5    8    1-8       1-8   (92)
 24 KOG4742 Predicted chitinase [G  26.6      70  0.0015   26.3   2.9    9   54-62     37-45  (286)
 25 PF12729 4HB_MCP_1:  Four helix  26.4 1.2E+02  0.0026   19.6   3.6   10    6-15      7-16  (181)
 26 PRK04598 tatA twin arginine tr  25.8      58  0.0013   22.1   2.0   12    9-20     10-21  (81)
 27 PLN03161 Probable xyloglucan e  25.7      55  0.0012   26.6   2.2   14    1-14      1-14  (291)
 28 PF05887 Trypan_PARP:  Procycli  25.5      23  0.0005   26.6   0.0   21    1-21      1-21  (143)
 29 PRK03554 tatA twin arginine tr  25.1      60  0.0013   22.6   2.0   13    8-20      9-21  (89)
 30 PRK12750 cpxP periplasmic repr  25.0 1.1E+02  0.0023   22.7   3.4   18    1-18      1-18  (170)
 31 TIGR01614 PME_inhib pectineste  24.7      42  0.0009   23.4   1.2   18   40-57     31-48  (178)
 32 PF00879 Defensin_propep:  Defe  24.2      83  0.0018   19.8   2.3   16    6-21      2-17  (52)
 33 MTH00260 ATP8 ATP synthase F0   23.7 1.2E+02  0.0027   18.6   3.0   15    1-15      4-18  (53)
 34 PF02533 PsbK:  Photosystem II   23.7      85  0.0019   19.2   2.2   12   13-24     27-38  (42)
 35 PF15284 PAGK:  Phage-encoded v  23.3 1.8E+02  0.0038   19.0   3.8   19    5-23      5-24  (61)
 36 PRK04561 tatA twin arginine tr  23.1      84  0.0018   21.2   2.3   11   10-20     11-21  (75)
 37 PRK00888 ftsB cell division pr  21.7      99  0.0022   21.2   2.5   15    6-20      2-16  (105)
 38 PRK02958 tatA twin arginine tr  21.6      78  0.0017   21.0   1.9   12    9-20     10-21  (73)
 39 PF00895 ATP-synt_8:  ATP synth  21.6 1.7E+02  0.0037   16.6   3.3   12    1-12      4-15  (54)
 40 PRK00720 tatA twin arginine tr  21.4      78  0.0017   21.3   1.9   12    9-20     10-21  (78)
 41 PRK01614 tatE twin arginine tr  20.5      82  0.0018   21.8   1.9   12    9-20     10-21  (85)
 42 PRK01833 tatA twin arginine tr  20.5      86  0.0019   20.9   2.0   12    9-20     10-21  (74)

No 1  
>PF02704 GASA:  Gibberellin regulated protein;  InterPro: IPR003854 This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds.
Probab=100.00  E-value=9.2e-38  Score=201.18  Aligned_cols=60  Identities=57%  Similarity=1.384  Sum_probs=59.4

Q ss_pred             CchHHhhHHhhcCCCCChHHHHHHhhcCcccccCCCCCCCCCCCCcccccccCCCCCCCC
Q 041400           36 QCASACNYRCSATSHRNPCIEFCNMCCKKCLCVPSGTYGHKEECPCYNNWKTKEGTPKCP   95 (95)
Q Consensus        36 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~Gtygnk~~CpCY~~~~t~~g~pKCP   95 (95)
                      ||+++|++|||+++++++||++||+||++|+|||||||||+|+||||+||+||+|+||||
T Consensus         1 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~gn~~~CpCY~~m~t~~g~pKCP   60 (60)
T PF02704_consen    1 DCGGACSVRCSKASRKKRCMRACGTCCAKCKCVPPGTYGNKEECPCYRDMKTHGGKPKCP   60 (60)
T ss_pred             CcchHHHHHHhccCCchHHHHHHHHHhccCcccCCCCCCCCccCCChhhhhccCCCCCCc
Confidence            799999999999999999999999999999999999999999999999999999999999


No 2  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=94.98  E-value=0.033  Score=38.22  Aligned_cols=20  Identities=20%  Similarity=0.303  Sum_probs=9.2

Q ss_pred             CcchhHHHHHHHHHHHHHHH
Q 041400            1 MARLSWSSIALVLFLSVVFA   20 (95)
Q Consensus         1 MA~~~~~l~~~ll~l~~~f~   20 (95)
                      ||+++-||+++||+++||++
T Consensus         1 MaSK~~llL~l~LA~lLlis   20 (95)
T PF07172_consen    1 MASKAFLLLGLLLAALLLIS   20 (95)
T ss_pred             CchhHHHHHHHHHHHHHHHH
Confidence            88544334444443433333


No 3  
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=84.15  E-value=1.5  Score=29.00  Aligned_cols=25  Identities=28%  Similarity=0.189  Sum_probs=14.4

Q ss_pred             CcchhHHHHHHHHHHHHHHHHHHHHhC
Q 041400            1 MARLSWSSIALVLFLSVVFAVEVANAG   27 (95)
Q Consensus         1 MA~~~~~l~~~ll~l~~~f~~~~~~~g   27 (95)
                      ||  .|++++.||-++++.+.|.+-.+
T Consensus         1 MA--~Kl~vialLC~aLva~vQ~APQY   25 (65)
T PF10731_consen    1 MA--SKLIVIALLCVALVAIVQSAPQY   25 (65)
T ss_pred             Cc--chhhHHHHHHHHHHHHHhcCccc
Confidence            77  56776666666555554544333


No 4  
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=83.34  E-value=1.1  Score=27.26  Aligned_cols=39  Identities=18%  Similarity=0.237  Sum_probs=18.4

Q ss_pred             CcchhHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCchHH
Q 041400            1 MARLSWSSIALVLFLSVVFAVEVANAGGEGSLKPEQCASA   40 (95)
Q Consensus         1 MA~~~~~l~~~ll~l~~~f~~~~~~~gg~gsl~~~~C~~~   40 (95)
                      ||.+.+++-+++++++++++ .........=....||+..
T Consensus         1 Ma~ilKFvY~mIiflslflv-~~~~~~~~~C~~d~DCp~~   39 (54)
T PF07127_consen    1 MAKILKFVYAMIIFLSLFLV-VTNVDAIIPCKTDSDCPKD   39 (54)
T ss_pred             CccchhhHHHHHHHHHHHHh-hcccCCCcccCccccCCCC
Confidence            88887776554444333222 2111111111355688776


No 5  
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=74.68  E-value=4  Score=28.23  Aligned_cols=24  Identities=17%  Similarity=0.329  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhCCC
Q 041400            6 WSSIALVLFLSVVFAVEVANAGGE   29 (95)
Q Consensus         6 ~~l~~~ll~l~~~f~~~~~~~gg~   29 (95)
                      .+|+.+++++|++..+|.++.|++
T Consensus        29 tILivLVIIiLlImlfqsSS~~~~   52 (85)
T PF10717_consen   29 TILIVLVIIILLIMLFQSSSNGNS   52 (85)
T ss_pred             HHHHHHHHHHHHHHHHhccCCCCC
Confidence            344455455445555566555443


No 6  
>PF09257 BCMA-Tall_bind:  BCMA, TALL-1 binding;  InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 2KN1_A 1OQD_R 1XU2_T.
Probab=65.71  E-value=5.7  Score=23.92  Aligned_cols=21  Identities=38%  Similarity=1.037  Sum_probs=16.6

Q ss_pred             HhhHHhhcCCCCChHHHHHHh
Q 041400           40 ACNYRCSATSHRNPCIEFCNM   60 (95)
Q Consensus        40 ~C~~RCs~~~~~~~C~~~C~~   60 (95)
                      -|.-|||+..-+-.|.+||+.
T Consensus        16 PChLRCsn~tPP~~Cq~YCna   36 (39)
T PF09257_consen   16 PCHLRCSNNTPPLPCQRYCNA   36 (39)
T ss_dssp             EHHHHHTSSS--TTTHHHHHH
T ss_pred             cceeecCCCCCCccchhhccc
Confidence            388999998888999999984


No 7  
>PLN03207 stomagen; Provisional
Probab=56.67  E-value=20  Score=25.88  Aligned_cols=6  Identities=50%  Similarity=1.863  Sum_probs=2.4

Q ss_pred             hhHHhh
Q 041400           41 CNYRCS   46 (95)
Q Consensus        41 C~~RCs   46 (95)
                      |.+||+
T Consensus        84 cr~kc~   89 (113)
T PLN03207         84 CRYKCR   89 (113)
T ss_pred             cccccc
Confidence            344443


No 8  
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.34  E-value=13  Score=25.30  Aligned_cols=17  Identities=18%  Similarity=0.364  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 041400            7 SSIALVLFLSVVFAVEV   23 (95)
Q Consensus         7 ~l~~~ll~l~~~f~~~~   23 (95)
                      +|++|.++|++++.|.+
T Consensus         4 ~lltFg~Fllvi~gMsi   20 (77)
T COG2991           4 FLLTFGIFLLVIAGMSI   20 (77)
T ss_pred             HHHHHHHHHHHHHHHhH
Confidence            45555555555555543


No 9  
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=49.80  E-value=16  Score=26.72  Aligned_cols=26  Identities=46%  Similarity=1.156  Sum_probs=18.3

Q ss_pred             HhhcCcccccCCCCCCC-------CCCC-Cccccccc
Q 041400           59 NMCCKKCLCVPSGTYGH-------KEEC-PCYNNWKT   87 (95)
Q Consensus        59 ~~CC~~C~CVP~Gtygn-------k~~C-pCY~~~~t   87 (95)
                      +.||.+|   |||||=.       .-+| ||-..-.|
T Consensus        41 ~~CC~kC---PPGt~v~~~Ct~~t~T~C~PCp~GTYT   74 (127)
T PHA02637         41 NLCCLSC---PPGTYASRLCDIKTNTQCTPCGSGTFT   74 (127)
T ss_pred             CeEcCCC---CCCCEEeCcCCCCCCcccccCCCCCee
Confidence            6788888   7887653       3478 88776655


No 10 
>PF10690 Myticin-prepro:  Myticin pre-proprotein from the mussel;  InterPro: IPR019631  Myticin is a cysteine-rich peptide produced in three isoforms, A, B and C, by Mytilus galloprovincialis (Mediterranean mussel). Isoforms A and B show antibacterial activity against Gram-positive bacteria, while isoform B is additionally active against the fungus Fusarium oxysporum and a Gram-negative bacterium, Escherichia coli (streptomycin resistant strain D31) []. Myticin-prepro is the precursor peptide. The mature molecule, named myticin, consists of 40 residues, with four intramolecular disulphide bridges and a cysteine array in the primary structure different from that of previously characterised cysteine-rich antimicrobial peptides. The first 20 amino acids are a putative signal peptide, and the antimicrobial peptide sequence is a 36-residue C-terminal extension. Such a structure suggests that myticins are synthesised as prepro-proteins that are then processed by various proteolytic events before storage in the haemocytes as the active peptide. Myticin precursors are expressed mainly in the haemocytes. ; PDB: 2EEM_A.
Probab=48.37  E-value=9.4  Score=27.04  Aligned_cols=14  Identities=29%  Similarity=0.719  Sum_probs=8.2

Q ss_pred             CCchHH-hhHHhhcC
Q 041400           35 EQCASA-CNYRCSAT   48 (95)
Q Consensus        35 ~~C~~~-C~~RCs~~   48 (95)
                      +.|.+. |+.+|..+
T Consensus        23 ~~CtS~yC~~fCgsa   37 (98)
T PF10690_consen   23 ISCTSYYCKKFCGSA   37 (98)
T ss_dssp             --HHHH-HHHHHHHT
T ss_pred             cccchhHHHHhcCCC
Confidence            457776 77777644


No 11 
>PF11912 DUF3430:  Protein of unknown function (DUF3430);  InterPro: IPR021837  This family of proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 209 to 265 amino acids in length. 
Probab=45.27  E-value=17  Score=26.12  Aligned_cols=10  Identities=30%  Similarity=0.305  Sum_probs=4.2

Q ss_pred             hHHHHHHHHH
Q 041400            5 SWSSIALVLF   14 (95)
Q Consensus         5 ~~~l~~~ll~   14 (95)
                      ||+|++|+|+
T Consensus         1 MKll~~lill   10 (212)
T PF11912_consen    1 MKLLISLILL   10 (212)
T ss_pred             CcHHHHHHHH
Confidence            3554333333


No 12 
>PF12438 DUF3679:  Protein of unknown function (DUF3679) ;  InterPro: IPR020534 This entry contains proteins with no known function.
Probab=40.95  E-value=39  Score=21.60  Aligned_cols=19  Identities=26%  Similarity=0.614  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q 041400            8 SIALVLFLSVVFAVEVANA   26 (95)
Q Consensus         8 l~~~ll~l~~~f~~~~~~~   26 (95)
                      ++++++++-++|-+|++..
T Consensus         4 ~~~~il~~gVl~Gmq~An~   22 (56)
T PF12438_consen    4 LLVIILFFGVLLGMQQANH   22 (56)
T ss_pred             HHHHHHHHHHHHhHHHHHh
Confidence            4555555567777888763


No 13 
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=38.95  E-value=39  Score=19.54  Aligned_cols=28  Identities=36%  Similarity=0.714  Sum_probs=20.4

Q ss_pred             cccccCCCCCCCC---CCC-CcccccccCCCC
Q 041400           64 KCLCVPSGTYGHK---EEC-PCYNNWKTKEGT   91 (95)
Q Consensus        64 ~C~CVP~Gtygnk---~~C-pCY~~~~t~~g~   91 (95)
                      .|.=.|.|||-+.   .+| +|-.+..|...+
T Consensus        10 ~C~~Cp~GtYq~~~g~~~C~~Cp~g~~T~~~G   41 (48)
T PF07699_consen   10 KCQPCPKGTYQDEEGQTSCTPCPPGSTTSSEG   41 (48)
T ss_pred             ccCCCCCCccCCccCCccCccCcCCCccCCcC
Confidence            4555689999854   579 899998885543


No 14 
>PF08027 Albumin_I:  Albumin I;  InterPro: IPR012512 The albumin I protein, a hormone-like peptide, stimulates kinase activity upon binding a membrane bound 43 kDa receptor. The structure of this region reveals a knottin like fold, comprise of three beta strands [].; GO: 0045735 nutrient reservoir activity, 0009405 pathogenesis; PDB: 1P8B_A 1JU8_A.
Probab=38.55  E-value=7.5  Score=28.39  Aligned_cols=12  Identities=33%  Similarity=0.996  Sum_probs=8.1

Q ss_pred             CcccccCCCCCC
Q 041400           63 KKCLCVPSGTYG   74 (95)
Q Consensus        63 ~~C~CVP~Gtyg   74 (95)
                      .+|.|+|-|..+
T Consensus        37 s~CrCiP~~l~~   48 (120)
T PF08027_consen   37 SDCRCIPWGLFV   48 (120)
T ss_dssp             TTSEEEE-SSS-
T ss_pred             CCeeEEEeeecc
Confidence            579999988654


No 15 
>PF03058 Sar8_2:  Sar8.2 family;  InterPro: IPR004297 Members of this family are found in Solanaceae spp. plants, a taxonomic group (family) that includes pepper and tobacco plant species. Synthesis of these proteins is induced by Tobacco mosaic virus and salicylic acid []; indeed they are thought to be involved in the development of systemic acquired resistance (SAR) after an initial hypersensitive response to microbial infection [, ]. SAR is characterised by long-lasting resistance to infection by a wide range of pathogens, extending to plant tissues distant from the initial infection site [].
Probab=38.28  E-value=48  Score=23.31  Aligned_cols=13  Identities=23%  Similarity=0.141  Sum_probs=7.6

Q ss_pred             CcchhHHHHHHHH
Q 041400            1 MARLSWSSIALVL   13 (95)
Q Consensus         1 MA~~~~~l~~~ll   13 (95)
                      |+....+|+-|.|
T Consensus         1 M~~Ktnlfl~lSL   13 (93)
T PF03058_consen    1 MVSKTNLFLCLSL   13 (93)
T ss_pred             CcchhhhHHHHHH
Confidence            6766666654444


No 16 
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=37.64  E-value=11  Score=19.55  Aligned_cols=9  Identities=33%  Similarity=0.291  Sum_probs=3.3

Q ss_pred             HHHHHHHHH
Q 041400            6 WSSIALVLF   14 (95)
Q Consensus         6 ~~l~~~ll~   14 (95)
                      ++.++++++
T Consensus         3 k~vIIlvvL   11 (19)
T PF13956_consen    3 KLVIILVVL   11 (19)
T ss_pred             eehHHHHHH
Confidence            333333333


No 17 
>PF15240 Pro-rich:  Proline-rich
Probab=35.79  E-value=24  Score=27.17  Aligned_cols=15  Identities=13%  Similarity=0.140  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHHH
Q 041400            8 SIALVLFLSVVFAVE   22 (95)
Q Consensus         8 l~~~ll~l~~~f~~~   22 (95)
                      ||||.++||+|.++|
T Consensus         3 lVLLSvALLALSSAQ   17 (179)
T PF15240_consen    3 LVLLSVALLALSSAQ   17 (179)
T ss_pred             hHHHHHHHHHhhhcc
Confidence            344444444444443


No 18 
>PRK09039 hypothetical protein; Validated
Probab=31.52  E-value=61  Score=26.30  Aligned_cols=15  Identities=27%  Similarity=0.452  Sum_probs=6.6

Q ss_pred             hHHHHHHHHHHHHHHH
Q 041400            5 SWSSIALVLFLSVVFA   20 (95)
Q Consensus         5 ~~~l~~~ll~l~~~f~   20 (95)
                      +.+|++++|+| ++|+
T Consensus        24 ~~ll~~~~f~l-~~f~   38 (343)
T PRK09039         24 STLLLVIMFLL-TVFV   38 (343)
T ss_pred             HHHHHHHHHHH-HHHH
Confidence            34444444444 3444


No 19 
>PF10868 DUF2667:  Protein of unknown function (DUF2667);  InterPro: IPR022618  This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana. 
Probab=30.44  E-value=22  Score=24.64  Aligned_cols=21  Identities=33%  Similarity=0.564  Sum_probs=12.6

Q ss_pred             cccCCCCCCCCCCCCcccccc
Q 041400           66 LCVPSGTYGHKEECPCYNNWK   86 (95)
Q Consensus        66 ~CVP~Gtygnk~~CpCY~~~~   86 (95)
                      .|+|-|...-...|-|..+-+
T Consensus        62 ~C~~~~~~~~~~~C~Cc~~~~   82 (90)
T PF10868_consen   62 QCVPVGPPPGDGVCYCCYYVK   82 (90)
T ss_pred             eeccCCCCCCCcEEEEeccCC
Confidence            367755544567886665543


No 20 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=29.40  E-value=2.7  Score=24.82  Aligned_cols=42  Identities=31%  Similarity=0.920  Sum_probs=28.5

Q ss_pred             CCCchHHhhHHhhcCCCCChHHHHHHhhcCcccccCCCCCCCCC-CC
Q 041400           34 PEQCASACNYRCSATSHRNPCIEFCNMCCKKCLCVPSGTYGHKE-EC   79 (95)
Q Consensus        34 ~~~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~Gtygnk~-~C   79 (95)
                      ..+|++.|...|+.......|..   .|=.-|.| |+|++-|.+ .|
T Consensus         7 y~~C~~~C~~tC~~~~~~~~C~~---~C~~gC~C-~~G~v~~~~~~C   49 (55)
T PF01826_consen    7 YSECGSPCPRTCDNPNNPEPCSE---PCVEGCFC-PPGYVRNDNGRC   49 (55)
T ss_dssp             EESSETSTTCBSSCTTTSSSCSS---S-ESEEEE-TTTEEEETTSEE
T ss_pred             eCcccCCcCCcCCCCCCCcCcCC---CCCccCCC-CCCeeEcCCCCE
Confidence            45899999999998777776663   33344677 568776554 44


No 21 
>PLN02995 Probable pectinesterase/pectinesterase inhibitor
Probab=28.35  E-value=1.4e+02  Score=26.21  Aligned_cols=16  Identities=25%  Similarity=0.482  Sum_probs=12.0

Q ss_pred             hhHHhhcCCCCChHHH
Q 041400           41 CNYRCSATSHRNPCIE   56 (95)
Q Consensus        41 C~~RCs~~~~~~~C~~   56 (95)
                      =...|+.+.+++.|.+
T Consensus        37 Irs~C~~T~YP~lC~s   52 (539)
T PLN02995         37 IDGWCDKTPYPDPCKC   52 (539)
T ss_pred             HHhhcCCCCChHHHHH
Confidence            3456899999998863


No 22 
>PRK00442 tatA twin arginine translocase protein A; Provisional
Probab=27.17  E-value=60  Score=22.54  Aligned_cols=12  Identities=25%  Similarity=0.670  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHHH
Q 041400            9 IALVLFLSVVFA   20 (95)
Q Consensus         9 ~~~ll~l~~~f~   20 (95)
                      ++++++++++|-
T Consensus        10 liIlvIvlllFG   21 (92)
T PRK00442         10 IVILVVVVLVFG   21 (92)
T ss_pred             HHHHHHHHHHhC
Confidence            444444445554


No 23 
>PF09919 DUF2149:  Uncharacterized conserved protein (DUF2149);  InterPro: IPR018676  This family of conserved hypothetical proteins has no known function. 
Probab=26.97  E-value=1.1e+02  Score=20.89  Aligned_cols=8  Identities=13%  Similarity=-0.134  Sum_probs=5.7

Q ss_pred             CcchhHHH
Q 041400            1 MARLSWSS    8 (95)
Q Consensus         1 MA~~~~~l    8 (95)
                      |+.+..||
T Consensus         1 m~gvvNL~    8 (92)
T PF09919_consen    1 MSGVVNLF    8 (92)
T ss_pred             CccHHHHH
Confidence            66677777


No 24 
>KOG4742 consensus Predicted chitinase [General function prediction only]
Probab=26.60  E-value=70  Score=26.32  Aligned_cols=9  Identities=22%  Similarity=0.922  Sum_probs=3.6

Q ss_pred             HHHHHHhhc
Q 041400           54 CIEFCNMCC   62 (95)
Q Consensus        54 C~~~C~~CC   62 (95)
                      +..+|+.-|
T Consensus        37 ~~~~~~~~c   45 (286)
T KOG4742|consen   37 TPPYCKFGC   45 (286)
T ss_pred             ccccccCCC
Confidence            334444433


No 25 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=26.37  E-value=1.2e+02  Score=19.59  Aligned_cols=10  Identities=10%  Similarity=0.082  Sum_probs=4.2

Q ss_pred             HHHHHHHHHH
Q 041400            6 WSSIALVLFL   15 (95)
Q Consensus         6 ~~l~~~ll~l   15 (95)
                      |+++.|++++
T Consensus         7 KL~~~f~~~~   16 (181)
T PF12729_consen    7 KLILGFGLII   16 (181)
T ss_pred             HHHHHHHHHH
Confidence            4544443333


No 26 
>PRK04598 tatA twin arginine translocase protein A; Provisional
Probab=25.80  E-value=58  Score=22.08  Aligned_cols=12  Identities=8%  Similarity=0.545  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHH
Q 041400            9 IALVLFLSVVFA   20 (95)
Q Consensus         9 ~~~ll~l~~~f~   20 (95)
                      ++++++++++|-
T Consensus        10 liIlvivlllFG   21 (81)
T PRK04598         10 LIIAVIVVLLFG   21 (81)
T ss_pred             HHHHHHHHHHhC
Confidence            444444445554


No 27 
>PLN03161 Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional
Probab=25.71  E-value=55  Score=26.62  Aligned_cols=14  Identities=36%  Similarity=0.216  Sum_probs=7.9

Q ss_pred             CcchhHHHHHHHHH
Q 041400            1 MARLSWSSIALVLF   14 (95)
Q Consensus         1 MA~~~~~l~~~ll~   14 (95)
                      ||++..||+++|++
T Consensus         1 ~~~~~~~~~~~~~~   14 (291)
T PLN03161          1 MASLKTLLVALFAA   14 (291)
T ss_pred             ChhHHHHHHHHHHH
Confidence            78765555555443


No 28 
>PF05887 Trypan_PARP:  Procyclic acidic repetitive protein (PARP);  InterPro: IPR008882 This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of T. brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated [].; GO: 0016020 membrane; PDB: 2X34_B 2X32_B.
Probab=25.54  E-value=23  Score=26.57  Aligned_cols=21  Identities=29%  Similarity=0.373  Sum_probs=0.0

Q ss_pred             CcchhHHHHHHHHHHHHHHHH
Q 041400            1 MARLSWSSIALVLFLSVVFAV   21 (95)
Q Consensus         1 MA~~~~~l~~~ll~l~~~f~~   21 (95)
                      |+.-+-+|+++||++++||+.
T Consensus         1 m~pr~l~~LavLL~~A~Lfag   21 (143)
T PF05887_consen    1 MTPRHLCLLAVLLFGAALFAG   21 (143)
T ss_dssp             ---------------------
T ss_pred             Ccccccccccccccccccccc
Confidence            564444566666666666764


No 29 
>PRK03554 tatA twin arginine translocase protein A; Provisional
Probab=25.06  E-value=60  Score=22.55  Aligned_cols=13  Identities=8%  Similarity=0.450  Sum_probs=5.8

Q ss_pred             HHHHHHHHHHHHH
Q 041400            8 SIALVLFLSVVFA   20 (95)
Q Consensus         8 l~~~ll~l~~~f~   20 (95)
                      |++++++++++|-
T Consensus         9 LlIIlvIvLLlFG   21 (89)
T PRK03554          9 LLIIAVIVVLLFG   21 (89)
T ss_pred             HHHHHHHHHHHhC
Confidence            3444444445554


No 30 
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=25.01  E-value=1.1e+02  Score=22.73  Aligned_cols=18  Identities=17%  Similarity=0.051  Sum_probs=8.4

Q ss_pred             CcchhHHHHHHHHHHHHH
Q 041400            1 MARLSWSSIALVLFLSVV   18 (95)
Q Consensus         1 MA~~~~~l~~~ll~l~~~   18 (95)
                      |..+.+++++++++.+++
T Consensus         1 ~~~~kkl~~~~v~~~l~l   18 (170)
T PRK12750          1 MKLAKKLVLAAVVLPLTL   18 (170)
T ss_pred             CchHHHHHHHHHHHHHHH
Confidence            444455655544443333


No 31 
>TIGR01614 PME_inhib pectinesterase inhibitor domain. This model describes a plant domain of about 200 amino acids, characterized by four conserved Cys residues, shown in a pectinesterase inhibitor from Kiwi to form two disulfide bonds: first to second and third to fourth. Roughly half the members of this family have the region described by this model followed immediately by a pectinesterase domain, pfam01095. This suggests that the pairing of the enzymatic domain and its inhibitor reflects a conserved regulatory mechanism for this enzyme family.
Probab=24.69  E-value=42  Score=23.38  Aligned_cols=18  Identities=28%  Similarity=0.346  Sum_probs=12.6

Q ss_pred             HhhHHhhcCCCCChHHHH
Q 041400           40 ACNYRCSATSHRNPCIEF   57 (95)
Q Consensus        40 ~C~~RCs~~~~~~~C~~~   57 (95)
                      .=+.-|..+.+++.|...
T Consensus        31 ~i~~~C~~t~~~~~C~~~   48 (178)
T TIGR01614        31 LIKRICKKTEYPNFCIST   48 (178)
T ss_pred             HHHHHHcCCCChHHHHHH
Confidence            445567888888888654


No 32 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=24.22  E-value=83  Score=19.84  Aligned_cols=16  Identities=13%  Similarity=0.135  Sum_probs=6.1

Q ss_pred             HHHHHHHHHHHHHHHH
Q 041400            6 WSSIALVLFLSVVFAV   21 (95)
Q Consensus         6 ~~l~~~ll~l~~~f~~   21 (95)
                      |.|.++.-+|+++|..
T Consensus         2 RTL~LLaAlLLlAlqa   17 (52)
T PF00879_consen    2 RTLALLAALLLLALQA   17 (52)
T ss_pred             cHHHHHHHHHHHHHHH
Confidence            3443333333344443


No 33 
>MTH00260 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=23.70  E-value=1.2e+02  Score=18.64  Aligned_cols=15  Identities=13%  Similarity=0.747  Sum_probs=8.4

Q ss_pred             CcchhHHHHHHHHHH
Q 041400            1 MARLSWSSIALVLFL   15 (95)
Q Consensus         1 MA~~~~~l~~~ll~l   15 (95)
                      ||++..+++.+++.+
T Consensus         4 msPm~W~~l~~~f~~   18 (53)
T MTH00260          4 LSPMSWLTAMIIFWF   18 (53)
T ss_pred             cccHHHHHHHHHHHH
Confidence            667666665444433


No 34 
>PF02533 PsbK:  Photosystem II 4 kDa reaction centre component;  InterPro: IPR003687 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbK found in PSII, where it is tightly associated with the antenna protein CP43 (PsbC). PsbK is required for accumulation of the PSII complex, and may participate in the assembly and stability of the PSII complex. In particular, PsbK may be involved in the binding of plastoquinone and in maintaining the dimeric organisation of PSII [, ].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center; PDB: 4FBY_K 3PRQ_K 1IZL_W 3BZ1_K 2AXT_K 1S5L_K 3PRR_K 3BZ2_K 3KZI_K 3A0B_k ....
Probab=23.68  E-value=85  Score=19.20  Aligned_cols=12  Identities=33%  Similarity=0.598  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHH
Q 041400           13 LFLSVVFAVEVA   24 (95)
Q Consensus        13 l~l~~~f~~~~~   24 (95)
                      |+++++|++|.+
T Consensus        27 lf~LLAfVWQAa   38 (42)
T PF02533_consen   27 LFFLLAFVWQAA   38 (42)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHh
Confidence            344568888865


No 35 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=23.31  E-value=1.8e+02  Score=19.04  Aligned_cols=19  Identities=21%  Similarity=0.231  Sum_probs=8.0

Q ss_pred             hHHHHHHHH-HHHHHHHHHH
Q 041400            5 SWSSIALVL-FLSVVFAVEV   23 (95)
Q Consensus         5 ~~~l~~~ll-~l~~~f~~~~   23 (95)
                      ...|++++| +++.+|....
T Consensus         5 ksifL~l~~~LsA~~FSasa   24 (61)
T PF15284_consen    5 KSIFLALVFILSAAGFSASA   24 (61)
T ss_pred             HHHHHHHHHHHHHhhhhHHH
Confidence            334433333 3344555443


No 36 
>PRK04561 tatA twin arginine translocase protein A; Provisional
Probab=23.05  E-value=84  Score=21.21  Aligned_cols=11  Identities=18%  Similarity=0.573  Sum_probs=4.5

Q ss_pred             HHHHHHHHHHH
Q 041400           10 ALVLFLSVVFA   20 (95)
Q Consensus        10 ~~ll~l~~~f~   20 (95)
                      +++++++++|-
T Consensus        11 IIlvIvlLlFG   21 (75)
T PRK04561         11 VVLVIVLLVFG   21 (75)
T ss_pred             HHHHHHHHHhC
Confidence            33333344443


No 37 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=21.70  E-value=99  Score=21.15  Aligned_cols=15  Identities=27%  Similarity=0.100  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHHH
Q 041400            6 WSSIALVLFLSVVFA   20 (95)
Q Consensus         6 ~~l~~~ll~l~~~f~   20 (95)
                      |+|+++++++++.|.
T Consensus         2 ~~~~~vll~ll~~l~   16 (105)
T PRK00888          2 RLLTLLLLALLVWLQ   16 (105)
T ss_pred             cHHHHHHHHHHHHHH
Confidence            344444444433333


No 38 
>PRK02958 tatA twin arginine translocase protein A; Provisional
Probab=21.57  E-value=78  Score=21.02  Aligned_cols=12  Identities=17%  Similarity=0.609  Sum_probs=5.0

Q ss_pred             HHHHHHHHHHHH
Q 041400            9 IALVLFLSVVFA   20 (95)
Q Consensus         9 ~~~ll~l~~~f~   20 (95)
                      ++++++++++|-
T Consensus        10 liIl~IvlllFG   21 (73)
T PRK02958         10 LIVLVIVVLVFG   21 (73)
T ss_pred             HHHHHHHHHHhC
Confidence            333344444443


No 39 
>PF00895 ATP-synt_8:  ATP synthase protein 8;  InterPro: IPR001421 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit 8 found in the F0 complex of mitochondrial F-ATPases from Metazoa. This subunit appears to be an integral component of the stator stalk in yeast mitochondrial F-ATPases []. The stator stalk is anchored in the membrane, and acts to prevent futile rotation of the ATPase subunits relative to the rotor during coupled ATP synthesis/hydrolysis. This subunit may have an analogous function in Metazoa. Subunit 8 differs in sequence between Metazoa, plants (IPR003319 from INTERPRO) and fungi (IPR009230 from INTERPRO). More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
Probab=21.57  E-value=1.7e+02  Score=16.61  Aligned_cols=12  Identities=17%  Similarity=0.501  Sum_probs=5.0

Q ss_pred             CcchhHHHHHHH
Q 041400            1 MARLSWSSIALV   12 (95)
Q Consensus         1 MA~~~~~l~~~l   12 (95)
                      |+.+..++.+++
T Consensus         4 L~P~~W~~~f~~   15 (54)
T PF00895_consen    4 LNPMPWFFLFLF   15 (54)
T ss_pred             CChHHHHHHHHH
Confidence            344444443333


No 40 
>PRK00720 tatA twin arginine translocase protein A; Provisional
Probab=21.42  E-value=78  Score=21.33  Aligned_cols=12  Identities=8%  Similarity=0.426  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHHH
Q 041400            9 IALVLFLSVVFA   20 (95)
Q Consensus         9 ~~~ll~l~~~f~   20 (95)
                      ++++++++++|-
T Consensus        10 lIIlvIvlllFG   21 (78)
T PRK00720         10 LIVLAVVLLLFG   21 (78)
T ss_pred             HHHHHHHHHHhC
Confidence            344444445554


No 41 
>PRK01614 tatE twin arginine translocase protein A; Validated
Probab=20.48  E-value=82  Score=21.78  Aligned_cols=12  Identities=8%  Similarity=0.531  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHHH
Q 041400            9 IALVLFLSVVFA   20 (95)
Q Consensus         9 ~~~ll~l~~~f~   20 (95)
                      ++++++++++|-
T Consensus        10 LIIlvIvLLLFG   21 (85)
T PRK01614         10 LVVGILIVLLFG   21 (85)
T ss_pred             HHHHHHHHHHhC
Confidence            333344445554


No 42 
>PRK01833 tatA twin arginine translocase protein A; Provisional
Probab=20.48  E-value=86  Score=20.87  Aligned_cols=12  Identities=17%  Similarity=0.581  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHH
Q 041400            9 IALVLFLSVVFA   20 (95)
Q Consensus         9 ~~~ll~l~~~f~   20 (95)
                      ++++++++++|-
T Consensus        10 liIl~i~lllFG   21 (74)
T PRK01833         10 LIIVAIIVLLFG   21 (74)
T ss_pred             HHHHHHHHHHhC
Confidence            333334444554


Done!