Query         041407
Match_columns 241
No_of_seqs    146 out of 1160
Neff          5.3 
Searched_HMMs 46136
Date          Fri Mar 29 06:44:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041407.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041407hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0703 Predicted GTPase-activ 100.0 9.8E-42 2.1E-46  308.7   6.7  109    1-109    15-127 (287)
  2 PF01412 ArfGap:  Putative GTPa 100.0 6.8E-40 1.5E-44  262.3   6.3  108    1-108     3-116 (116)
  3 smart00105 ArfGap Putative GTP 100.0 3.1E-38 6.7E-43  251.5  10.0  102    9-110     1-109 (112)
  4 COG5347 GTPase-activating prot 100.0 1.3E-34 2.9E-39  267.1   8.6  109    1-109    10-126 (319)
  5 PLN03119 putative ADP-ribosyla 100.0   3E-33 6.6E-38  270.4  10.4  112    1-115    13-131 (648)
  6 PLN03131 hypothetical protein; 100.0   8E-33 1.7E-37  269.3  10.3  113    1-116    13-132 (705)
  7 PLN03114 ADP-ribosylation fact 100.0 7.1E-29 1.5E-33  230.0   9.3  110    1-110    12-130 (395)
  8 KOG0704 ADP-ribosylation facto 100.0   6E-29 1.3E-33  229.3   7.2  105    3-107    11-126 (386)
  9 KOG0706 Predicted GTPase-activ  99.9   9E-29 1.9E-33  233.8   6.4   82    1-82     13-94  (454)
 10 KOG0705 GTPase-activating prot  99.9 3.7E-28   8E-33  235.2   7.8  112    2-113   504-621 (749)
 11 KOG0521 Putative GTPase activa  99.9 2.6E-25 5.7E-30  225.2   2.9  112    2-113   417-536 (785)
 12 KOG0818 GTPase-activating prot  99.8 5.2E-22 1.1E-26  190.3   5.4  106    5-110     2-121 (669)
 13 KOG1117 Rho- and Arf-GTPase ac  99.8 2.6E-19 5.6E-24  179.7   3.9  103    7-109   294-404 (1186)
 14 KOG0702 Predicted GTPase-activ  99.6   1E-15 2.3E-20  146.9   6.3  109    1-110    15-131 (524)
 15 KOG0521 Putative GTPase activa  93.0   0.022 4.7E-07   59.3  -0.7   73    7-81    626-699 (785)
 16 PF00643 zf-B_box:  B-box zinc   81.3     1.6 3.4E-05   28.1   2.5   34   10-43      2-36  (42)
 17 PRK00085 recO DNA repair prote  79.5     1.1 2.4E-05   39.3   1.8   36    3-38    141-177 (247)
 18 TIGR00613 reco DNA repair prot  70.2     3.2 6.9E-05   36.3   2.2   38    3-40    139-177 (241)
 19 PF08271 TF_Zn_Ribbon:  TFIIB z  70.1     2.6 5.7E-05   27.7   1.3   27   13-40      2-28  (43)
 20 PF01286 XPA_N:  XPA protein N-  63.5     2.4 5.2E-05   27.4   0.1   27   12-38      4-31  (34)
 21 PF11781 RRN7:  RNA polymerase   63.4       6 0.00013   25.6   1.9   27   10-39      7-33  (36)
 22 smart00401 ZnF_GATA zinc finge  55.5      13 0.00028   25.7   2.7   37   10-46      2-40  (52)
 23 PF00320 GATA:  GATA zinc finge  54.3      11 0.00023   24.1   1.9   32   14-45      1-34  (36)
 24 cd01236 PH_outspread Outspread  53.3     5.3 0.00012   31.5   0.5   62  132-197    19-80  (104)
 25 COG1381 RecO Recombinational D  52.3     6.7 0.00014   35.3   1.0   35    4-38    147-182 (251)
 26 cd07171 NR_DBD_ER DNA-binding   51.3      11 0.00025   28.4   2.0   31   10-43      2-32  (82)
 27 cd01264 PH_melted Melted pleck  49.8     6.5 0.00014   31.0   0.4   58  135-197    17-77  (101)
 28 cd01251 PH_centaurin_alpha Cen  48.0      14 0.00031   28.5   2.1   36  135-176    14-49  (103)
 29 cd07173 NR_DBD_AR DNA-binding   44.7      15 0.00033   27.8   1.7   31   10-43      2-32  (82)
 30 cd06968 NR_DBD_ROR DNA-binding  43.0      18 0.00039   28.1   2.0   32    9-43      3-34  (95)
 31 cd07160 NR_DBD_LXR DNA-binding  42.6      18 0.00039   28.5   2.0   31   10-43     17-47  (101)
 32 cd07170 NR_DBD_ERR DNA-binding  41.8      18 0.00039   28.3   1.8   30   11-43      4-33  (97)
 33 PF14803 Nudix_N_2:  Nudix N-te  41.3      11 0.00024   24.2   0.4   30   12-42      1-33  (34)
 34 PRK12495 hypothetical protein;  41.1      17 0.00038   32.8   1.8   30    7-40     38-67  (226)
 35 cd01260 PH_CNK Connector enhan  39.2      11 0.00024   28.1   0.3   54  136-197    19-72  (96)
 36 PRK00423 tfb transcription ini  38.4      23  0.0005   32.8   2.3   35    7-42      7-41  (310)
 37 TIGR02419 C4_traR_proteo phage  38.3     9.2  0.0002   27.6  -0.3   35    7-41     27-62  (63)
 38 cd06966 NR_DBD_CAR DNA-binding  35.5      19 0.00041   27.9   1.0   29   12-43      1-29  (94)
 39 PF07282 OrfB_Zn_ribbon:  Putat  34.0      26 0.00056   24.8   1.5   27   11-39     28-54  (69)
 40 cd07161 NR_DBD_EcR DNA-binding  33.7      30 0.00065   26.6   1.9   29   12-43      2-30  (91)
 41 cd07169 NR_DBD_GCNF_like DNA-b  32.7      31 0.00067   26.5   1.8   32    9-43      4-35  (90)
 42 cd07172 NR_DBD_GR_PR DNA-bindi  32.6      31 0.00068   25.7   1.8   29   12-43      3-31  (78)
 43 PF01258 zf-dskA_traR:  Prokary  32.6     6.3 0.00014   25.0  -1.7   29   13-41      5-34  (36)
 44 cd01238 PH_Tec Tec pleckstrin   32.5      20 0.00042   27.9   0.7   58  135-196    19-82  (106)
 45 COG1997 RPL43A Ribosomal prote  32.0      34 0.00075   26.7   1.9   32    7-40     31-62  (89)
 46 KOG3507 DNA-directed RNA polym  31.9      24 0.00052   25.6   1.0   23   12-37     21-43  (62)
 47 cd07162 NR_DBD_PXR DNA-binding  31.8      33 0.00071   26.1   1.8   28   13-43      1-28  (87)
 48 PF10764 Gin:  Inhibitor of sig  30.1      30 0.00066   23.6   1.2   26   13-39      1-26  (46)
 49 cd06956 NR_DBD_RXR DNA-binding  30.0      39 0.00084   25.0   1.9   28   13-43      2-29  (77)
 50 cd07163 NR_DBD_TLX DNA-binding  29.9      23 0.00051   27.2   0.7   30   11-43      6-35  (92)
 51 PF04189 Gcd10p:  Gcd10p family  29.7      49  0.0011   31.0   2.9   46   57-103   106-151 (299)
 52 cd01265 PH_PARIS-1 PARIS-1 ple  29.0      30 0.00064   26.2   1.2   55  135-196    15-69  (95)
 53 cd03031 GRX_GRX_like Glutaredo  28.8      32  0.0007   28.7   1.4   28    8-44     96-123 (147)
 54 PF12760 Zn_Tnp_IS1595:  Transp  28.8      47   0.001   22.0   2.0   32    6-38     13-44  (46)
 55 cd07158 NR_DBD_Ppar_like The D  28.4      33 0.00072   25.0   1.3   27   14-43      1-27  (73)
 56 cd06965 NR_DBD_Ppar DNA-bindin  28.1      26 0.00057   26.5   0.7   27   14-43      2-28  (84)
 57 cd07156 NR_DBD_VDR_like The DN  27.8      37 0.00081   24.7   1.5   27   14-43      1-27  (72)
 58 cd06963 NR_DBD_GR_like The DNA  27.7      41 0.00089   24.7   1.7   27   14-43      1-27  (73)
 59 PF14471 DUF4428:  Domain of un  27.2      24 0.00052   24.4   0.3   30   13-43      1-32  (51)
 60 cd07179 2DBD_NR_DBD2 The secon  27.2      43 0.00093   24.6   1.7   27   14-43      1-27  (74)
 61 cd06955 NR_DBD_VDR DNA-binding  27.2      30 0.00065   27.6   0.9   30   11-43      6-35  (107)
 62 cd07166 NR_DBD_REV_ERB DNA-bin  26.5      31 0.00066   26.4   0.8   30   11-43      3-32  (89)
 63 smart00290 ZnF_UBP Ubiquitin C  26.3      44 0.00094   22.0   1.5   22   13-34      1-22  (50)
 64 COG1734 DksA DnaK suppressor p  26.2      13 0.00029   30.3  -1.3   31   12-42     81-112 (120)
 65 cd07165 NR_DBD_DmE78_like DNA-  26.1      37 0.00079   25.4   1.2   27   14-43      1-27  (81)
 66 cd07168 NR_DBD_DHR4_like DNA-b  26.1      47   0.001   25.4   1.8   31   10-43      5-35  (90)
 67 cd07155 NR_DBD_ER_like DNA-bin  26.1      36 0.00077   25.0   1.1   27   14-43      1-27  (75)
 68 COG2174 RPL34A Ribosomal prote  25.8      45 0.00097   26.2   1.6   34    6-39     29-79  (93)
 69 PRK11019 hypothetical protein;  25.4      18 0.00038   28.1  -0.7   37   10-47     35-73  (88)
 70 PF00105 zf-C4:  Zinc finger, C  25.3      48   0.001   23.6   1.6   28   12-42      1-28  (70)
 71 PRK03681 hypA hydrogenase nick  25.2      29 0.00064   27.6   0.5   33    6-41     65-97  (114)
 72 cd07157 2DBD_NR_DBD1 The first  24.8      32  0.0007   26.1   0.7   28   13-43      2-29  (86)
 73 cd00202 ZnF_GATA Zinc finger D  24.7      48   0.001   23.1   1.5   33   13-45      1-35  (54)
 74 PF06827 zf-FPG_IleRS:  Zinc fi  24.7      36 0.00077   20.5   0.7   28   12-39      2-29  (30)
 75 cd06958 NR_DBD_COUP_TF DNA-bin  24.3      41  0.0009   24.6   1.1   27   14-43      1-27  (73)
 76 KOG1416 tRNA(1-methyladenosine  23.4      66  0.0014   32.0   2.6   43   59-102   115-157 (475)
 77 PF09297 zf-NADH-PPase:  NADH p  23.3      40 0.00086   20.7   0.8   25   10-40      2-30  (32)
 78 cd06959 NR_DBD_EcR_like The DN  23.3      52  0.0011   24.0   1.5   27   14-43      2-28  (73)
 79 cd06962 NR_DBD_FXR DNA-binding  22.3      38 0.00083   25.6   0.7   28   13-43      3-30  (84)
 80 cd06960 NR_DBD_HNF4A DNA-bindi  22.3      43 0.00094   24.6   0.9   27   14-43      1-27  (76)
 81 COG2158 Uncharacterized protei  21.7      55  0.0012   26.4   1.5   31   14-46     45-77  (112)
 82 COG0675 Transposase and inacti  21.5      41 0.00089   29.7   0.8   22   12-40    310-331 (364)
 83 cd01245 PH_RasGAP_CG5898 RAS G  21.4      43 0.00094   26.1   0.8   61  136-198    15-75  (98)
 84 smart00399 ZnF_C4 c4 zinc fing  21.4      51  0.0011   23.7   1.1   27   14-43      2-28  (70)
 85 smart00659 RPOLCX RNA polymera  21.3      44 0.00095   22.5   0.7   27   13-44      4-30  (44)
 86 TIGR01384 TFS_arch transcripti  21.1      72  0.0016   24.4   2.0   28   11-38     62-97  (104)
 87 cd06967 NR_DBD_TR2_like DNA-bi  21.0      42 0.00092   25.5   0.7   29   12-43      4-32  (87)
 88 cd06961 NR_DBD_TR DNA-binding   21.0      48   0.001   25.1   0.9   27   14-43      2-28  (85)
 89 PHA00080 DksA-like zinc finger  20.7      30 0.00065   25.6  -0.2   35    8-43     28-64  (72)
 90 cd07164 NR_DBD_PNR_like_1 DNA-  20.3      57  0.0012   24.1   1.2   27   14-43      1-27  (78)
 91 cd01266 PH_Gab Gab (Grb2-assoc  20.2      54  0.0012   25.2   1.1   43  135-179    17-62  (108)

No 1  
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=100.00  E-value=9.8e-42  Score=308.74  Aligned_cols=109  Identities=61%  Similarity=1.119  Sum_probs=105.1

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWE   80 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wE   80 (241)
                      +|++|++.|+|+.|||||+++|+|||+|+|||||+.|+||||.||+|||+||||+||.|++|+|+.|+..||.+||++||
T Consensus        15 ~l~~Ll~~~~N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkVkSv~LD~W~~eqv~~m~~~GN~~an~~~e   94 (287)
T KOG0703|consen   15 RLRELLREPDNKVCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKVKSVTLDEWTDEQVDFMISMGNAKANSYYE   94 (287)
T ss_pred             HHHHHHcCcccCcccccCCCCCCeEEeecCeEEEeecccccccccchhheeeeeeccccCHHHHHHHHHHcchhhhhhcc
Confidence            48899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCCChHH----HHHHHHHHHhcCccccCC
Q 041407           81 AELPPNFDRSR----IEKFIRTKYEERKWVQKG  109 (241)
Q Consensus        81 a~lP~~~d~~~----re~fIraKYv~K~F~~~~  109 (241)
                      +.+|..++++.    +|+|||+|||+|+|+.++
T Consensus        95 a~~p~~~~~p~~d~~~e~FIR~KYE~kkf~~~~  127 (287)
T KOG0703|consen   95 AKLPDPFRRPGPDDLVEQFIRDKYERKKFLDPE  127 (287)
T ss_pred             ccCCccccCCChHHHHHHHHHHHHhhhhhccch
Confidence            99999887654    999999999999999875


No 2  
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=100.00  E-value=6.8e-40  Score=262.32  Aligned_cols=108  Identities=55%  Similarity=1.078  Sum_probs=89.4

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWE   80 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wE   80 (241)
                      +|+.|++.|+|++|||||+++|+|||++||||||+.|+|+||.||+|+|+||||+||+|++++|++|+.+||.++|++||
T Consensus         3 ~l~~l~~~~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~VkSi~~d~w~~~ev~~~~~~GN~~~n~~~e   82 (116)
T PF01412_consen    3 ILRELLKKPGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRVKSITMDNWSPEEVQRMREGGNKRANSIWE   82 (116)
T ss_dssp             HHHHHHCSTTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--EEETTTS---HHHHHHHHHSHHHHHHHHHT
T ss_pred             HHHHHHcCcCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhccccccCCCCHHHHHHHHHHChHHHHHHHH
Confidence            58899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCC------CCChHHHHHHHHHHHhcCccccC
Q 041407           81 AELPP------NFDRSRIEKFIRTKYEERKWVQK  108 (241)
Q Consensus        81 a~lP~------~~d~~~re~fIraKYv~K~F~~~  108 (241)
                      ++.+.      ..+...+++||++||++++|+.+
T Consensus        83 ~~~~~~~~~~~~~~~~~~~~fI~~KY~~k~f~~~  116 (116)
T PF01412_consen   83 ANSPPPKKPPPSSDQEKREQFIRAKYVEKAFISK  116 (116)
T ss_dssp             TTSTTTTTHCTTSHHHHHHHHHHHHHTTHTTS-C
T ss_pred             cCCCCCCCCCCCCcHHHHHHHHHHHHHhhhhccC
Confidence            99422      23345699999999999999863


No 3  
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=100.00  E-value=3.1e-38  Score=251.50  Aligned_cols=102  Identities=55%  Similarity=1.036  Sum_probs=95.3

Q ss_pred             CCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHHhcCCCCC-
Q 041407            9 PENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWEAELPPNF-   87 (241)
Q Consensus         9 pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wEa~lP~~~-   87 (241)
                      |+|++|||||+++|+|||++||||||+.|+|+||.||+|||+||||+||+|++++|++|+.+||.++|++||+++|+.. 
T Consensus         1 ~~N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~VkSl~md~w~~~~i~~~~~~GN~~~n~~~e~~~~~~~~   80 (112)
T smart00105        1 PGNKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISKVRSLTLDTWTEEELRLLQKGGNENANSIWESNLDDFSL   80 (112)
T ss_pred             CCCCcccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCeeeecccCCCCHHHHHHHHHhhhHHHHHHHHhhCCcccc
Confidence            6899999999999999999999999999999999999999999999999999999999999999999999999986432 


Q ss_pred             ------ChHHHHHHHHHHHhcCccccCCC
Q 041407           88 ------DRSRIEKFIRTKYEERKWVQKGA  110 (241)
Q Consensus        88 ------d~~~re~fIraKYv~K~F~~~~~  110 (241)
                            +...+++||++||++|+|+.+.+
T Consensus        81 ~~~~~~~~~~~~~fI~~KY~~k~f~~~~~  109 (112)
T smart00105       81 KPPDSDDQQKYESFIAAKYEEKLFVPPES  109 (112)
T ss_pred             CCCCCchHHHHHHHHHHHHHhhhcccccc
Confidence                  34569999999999999998754


No 4  
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=100.00  E-value=1.3e-34  Score=267.08  Aligned_cols=109  Identities=49%  Similarity=0.943  Sum_probs=100.4

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWE   80 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wE   80 (241)
                      ++..|.+.++|+.|||||+++|+|||+|||||||++||||||+||+||++||||+||+|+++||++|..+||++||+|||
T Consensus        10 ~l~~l~~~~~Nk~CaDCga~~P~W~S~nlGvfiCi~CagvHRsLGvhiS~VKSitLD~wt~~~l~~m~~gGN~~a~~~~e   89 (319)
T COG5347          10 LLKLLKSDSSNKKCADCGAPNPTWASVNLGVFLCIDCAGVHRSLGVHISKVKSLTLDNWTEEELRRMEVGGNSNANRFYE   89 (319)
T ss_pred             HHHHHhhccccCccccCCCCCCceEecccCeEEEeecchhhhccccceeeeeeeecccCCHHHHHHHHHhcchhhhhHhc
Confidence            36778899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCC--------CCChHHHHHHHHHHHhcCccccCC
Q 041407           81 AELPP--------NFDRSRIEKFIRTKYEERKWVQKG  109 (241)
Q Consensus        81 a~lP~--------~~d~~~re~fIraKYv~K~F~~~~  109 (241)
                      .++-.        ..+...+++||+.||++++|....
T Consensus        90 ~~~~~~~~~~~k~~yd~~v~~~y~~~ky~~~~~~~~~  126 (319)
T COG5347          90 KNLLDQLLLPIKAKYDSSVAKKYIRKKYELKKFIDDS  126 (319)
T ss_pred             cCCCcccccccccccCHHHHHHHHHHHHHhhhccccc
Confidence            97422        235566999999999999999863


No 5  
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=100.00  E-value=3e-33  Score=270.40  Aligned_cols=112  Identities=29%  Similarity=0.689  Sum_probs=102.0

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWE   80 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wE   80 (241)
                      ||++|++.|+|+.|+|||+.+|+|||+|||||||+.|+||||.||   +|||||+||+|+++||++|+.+||+++|++||
T Consensus        13 ILreLlklPgNk~CADCgs~~P~WASiNlGIFICi~CSGIHRsLG---hRVKSLSLDkWT~EEVe~Mk~gGN~~AN~iye   89 (648)
T PLN03119         13 IIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT---HRVKSVSMSKFTSKEVEVLQNGGNQRAREIYL   89 (648)
T ss_pred             HHHHHhhCcCCCccccCCCCCCCceeeccceEEeccchhhhccCC---ceeeccccCCCCHHHHHHHHHhchHHHHHHHH
Confidence            689999999999999999999999999999999999999999998   49999999999999999999999999999999


Q ss_pred             hcCCC-------CCChHHHHHHHHHHHhcCccccCCCCCCcc
Q 041407           81 AELPP-------NFDRSRIEKFIRTKYEERKWVQKGATQPTT  115 (241)
Q Consensus        81 a~lP~-------~~d~~~re~fIraKYv~K~F~~~~~~~~~~  115 (241)
                      ++++.       ..+...+++|||+|||+|+|+.....+..+
T Consensus        90 anw~~~~~~~P~~sD~e~lr~FIR~KYVeKRF~~~~~~d~p~  131 (648)
T PLN03119         90 KNWDHQRQRLPENSNAERVREFIKNVYVQKKYAGANDADKPS  131 (648)
T ss_pred             hhcccccCCCCCCccHHHHHHHHHHHHhhhhccCcCCCCCCc
Confidence            98753       334556899999999999999987655443


No 6  
>PLN03131 hypothetical protein; Provisional
Probab=99.98  E-value=8e-33  Score=269.30  Aligned_cols=113  Identities=31%  Similarity=0.679  Sum_probs=102.0

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWE   80 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wE   80 (241)
                      ||++|++.|+|+.|+|||+++|+|||++||||||++|+||||.||   +|||||+||+|++++|++|+.+||.+||++||
T Consensus        13 iLreLlk~PgNk~CADCga~~P~WASiNlGIFICi~CSGIHRsLg---hRVKSVTLD~WtdeEV~~Mk~gGN~~AN~iye   89 (705)
T PLN03131         13 IIRGLMKLPPNRRCINCNSLGPQFVCTNFWTFICMTCSGIHREFT---HRVKSVSMSKFTSQDVEALQNGGNQRAREIYL   89 (705)
T ss_pred             HHHHHhhCcCCCccccCCCCCCCeeEeccceEEchhchhhhcccC---cccccccCCCCCHHHHHHHHHhccHHHHHHHH
Confidence            689999999999999999999999999999999999999999998   39999999999999999999999999999999


Q ss_pred             hcCC-------CCCChHHHHHHHHHHHhcCccccCCCCCCcch
Q 041407           81 AELP-------PNFDRSRIEKFIRTKYEERKWVQKGATQPTTK  116 (241)
Q Consensus        81 a~lP-------~~~d~~~re~fIraKYv~K~F~~~~~~~~~~~  116 (241)
                      ++++       .+.+...+++|||+|||+|+|+.....+..++
T Consensus        90 anwd~~r~~lP~~sd~ekrr~FIR~KYVeKRFa~~~s~d~ppr  132 (705)
T PLN03131         90 KDWDQQRQRLPDNSKVDKIREFIKDIYVDKKYAGGKTHDKPPR  132 (705)
T ss_pred             hhcccccCCCCCCccHHHHHHHHHHHHhhhhhhcCCCCCCCch
Confidence            9874       23345568999999999999999875554444


No 7  
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=99.95  E-value=7.1e-29  Score=230.00  Aligned_cols=110  Identities=39%  Similarity=0.666  Sum_probs=95.5

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWE   80 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wE   80 (241)
                      ||+.|+..|+|+.|+|||+++|+|+|++||||||+.|+|+||.||+||++|||++||.|++++|++|+.+||.++|+||+
T Consensus        12 vfrkL~~kPgNk~CaDCga~nPtWASvn~GIFLCl~CSGVHRsLGvHISfVRSltLD~Ws~eqL~~Mk~GGN~rA~~fF~   91 (395)
T PLN03114         12 VFKKLKAKSDNKICFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSSEQLKMMIYGGNNRAQVFFK   91 (395)
T ss_pred             HHHHHHhCcCCCcCccCCCCCCCceeeccceeehhhhhHhhccCCCCCceeecccCCCCCHHHHHHHHHhcCHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hcC-CCCCC-----hH---HHHHHHHHHHhcCccccCCC
Q 041407           81 AEL-PPNFD-----RS---RIEKFIRTKYEERKWVQKGA  110 (241)
Q Consensus        81 a~l-P~~~d-----~~---~re~fIraKYv~K~F~~~~~  110 (241)
                      .+- ....+     ..   .+-+-+.+|++.+.++.+..
T Consensus        92 qhG~~~~~~~~~KY~S~aA~~Yre~L~keVa~~~a~~~~  130 (395)
T PLN03114         92 QYGWSDGGKTEAKYTSRAADLYKQILAKEVAKSKAEEEL  130 (395)
T ss_pred             HcCCCCCCCcccccCCHHHHHHHHHHHHHHHHhhhcccc
Confidence            863 11111     11   13344888999998886653


No 8  
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=99.95  E-value=6e-29  Score=229.28  Aligned_cols=105  Identities=40%  Similarity=0.739  Sum_probs=86.5

Q ss_pred             HhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHHhc
Q 041407            3 EGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWEAE   82 (241)
Q Consensus         3 ~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wEa~   82 (241)
                      .+|+...+|++|+||++++|+|||++||||||++|||+||.||+|||+||||+||+|.+.||+.|+.+||+++++|++..
T Consensus        11 ~~lkp~deNk~CfeC~a~NPQWvSvsyGIfICLECSG~HRgLGVhiSFVRSVTMD~wkeiel~kMeaGGN~~~~eFL~s~   90 (386)
T KOG0704|consen   11 LELKPQDENKKCFECGAPNPQWVSVSYGIFICLECSGKHRGLGVHISFVRSVTMDKWKEIELKKMEAGGNERFREFLSSQ   90 (386)
T ss_pred             HhcCccccCCceeecCCCCCCeEeecccEEEEEecCCcccccceeeEEEEeeecccccHHHHHHHHhccchhHHHHHhhC
Confidence            34444459999999999999999999999999999999999999999999999999999999999999999999999886


Q ss_pred             C--CCCCC-hH--------HHHHHHHHHHhcCcccc
Q 041407           83 L--PPNFD-RS--------RIEKFIRTKYEERKWVQ  107 (241)
Q Consensus        83 l--P~~~d-~~--------~re~fIraKYv~K~F~~  107 (241)
                      -  .+..+ ++        ..++-|.+--+.+.|-+
T Consensus        91 ~~~~e~~~i~eKYns~aAa~yRdki~~laegr~w~d  126 (386)
T KOG0704|consen   91 GIYKETWPIREKYNSRAAALYRDKIAALAEGREWND  126 (386)
T ss_pred             ccccccccHHHhhccHHHHHHHHHHHHHhcCCcccc
Confidence            2  11111 11        14455666667777733


No 9  
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=99.95  E-value=9e-29  Score=233.76  Aligned_cols=82  Identities=50%  Similarity=0.925  Sum_probs=79.7

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWE   80 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wE   80 (241)
                      +++.|+.+++|++|||||+++|+|+|++||||||++||++||+|||||++|||+.||+|+..||++|+.|||++|+.|+.
T Consensus        13 vfkkLRs~~~NKvCFDCgAknPtWaSVTYGIFLCiDCSAvHRnLGVHiSFVRSTnLDsWs~~qLR~M~~GGN~nA~~FFk   92 (454)
T KOG0706|consen   13 VFKKLRSQSENKVCFDCGAKNPTWASVTYGIFLCIDCSAVHRNLGVHISFVRSTNLDSWSWEQLRRMQVGGNANARVFFK   92 (454)
T ss_pred             HHHHHhcCCCCceecccCCCCCCceeecceEEEEEecchhhhccccceEEEeecccccCCHHHHhHhhhcCchhHHHHHH
Confidence            36789999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hc
Q 041407           81 AE   82 (241)
Q Consensus        81 a~   82 (241)
                      .+
T Consensus        93 qh   94 (454)
T KOG0706|consen   93 QH   94 (454)
T ss_pred             Hc
Confidence            86


No 10 
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]
Probab=99.95  E-value=3.7e-28  Score=235.23  Aligned_cols=112  Identities=41%  Similarity=0.899  Sum_probs=102.4

Q ss_pred             hHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHHh
Q 041407            2 LEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWEA   81 (241)
Q Consensus         2 l~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wEa   81 (241)
                      |..+...+||..|+||+.++|.|||+|+|+.+|++|+||||.||.|+|+|||+.||.|..|.+..|..+||+.||++||.
T Consensus       504 ~qairn~rgn~~c~dc~~~n~~wAslnlg~l~cieCsgihr~lgt~lSrvr~LeLDdWPvEl~~Vm~aiGN~~AN~vWE~  583 (749)
T KOG0705|consen  504 LQAIRNMRGNSHCVDCGTPNPKWASLNLGVLMCIECSGIHRNLGTHLSRVRSLELDDWPVELLKVMSAIGNDLANSVWEG  583 (749)
T ss_pred             HHHHhcCcCCceeeecCCCCcccccccCCeEEEEEchhhhhhhhhhhhhhhccccccCcHHHHHHHHHhhhhHHHHHhhh
Confidence            56788999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             cC-----C-CCCChHHHHHHHHHHHhcCccccCCCCCC
Q 041407           82 EL-----P-PNFDRSRIEKFIRTKYEERKWVQKGATQP  113 (241)
Q Consensus        82 ~l-----P-~~~d~~~re~fIraKYv~K~F~~~~~~~~  113 (241)
                      .+     | +...|+.+|.||++||++|.|..+..-..
T Consensus       584 ~~~G~~KPs~~s~REEkErwIr~KYeqklFLaPl~~te  621 (749)
T KOG0705|consen  584 SSQGQTKPSPDSSREEKERWIRAKYEQKLFLAPLPCTE  621 (749)
T ss_pred             hccCCcCCCccccHHHHHHHHHHHHHHHhhcCCCCCCC
Confidence            54     2 23457779999999999999998865433


No 11 
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]
Probab=99.90  E-value=2.6e-25  Score=225.25  Aligned_cols=112  Identities=46%  Similarity=0.910  Sum_probs=103.3

Q ss_pred             hHhhhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHHh
Q 041407            2 LEGLLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWEA   81 (241)
Q Consensus         2 l~~L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wEa   81 (241)
                      +.++++.|||..|+|||++.|+|+|+|+|+.+|++|+|+||.||+|+|+|+|++||.|.++.+.+|+.+||..+|.+||+
T Consensus       417 ~~~vq~~pgN~~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD~~~~~l~~l~~~lgn~~~N~i~e~  496 (785)
T KOG0521|consen  417 IEEVQSVPGNAQCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLDVWEPELLLLFKNLGNKYVNEIYEA  496 (785)
T ss_pred             hhhhhcCCchhhhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhhccCcHHHHHHHHhCcchhhhhhhc
Confidence            56788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCC--------CChHHHHHHHHHHHhcCccccCCCCCC
Q 041407           82 ELPPN--------FDRSRIEKFIRTKYEERKWVQKGATQP  113 (241)
Q Consensus        82 ~lP~~--------~d~~~re~fIraKYv~K~F~~~~~~~~  113 (241)
                      +++.-        .++..|+.||++||++++|..+.....
T Consensus       497 ~l~~~~~~~~~~~~~~~~r~~~i~~kyve~~F~~k~~~~~  536 (785)
T KOG0521|consen  497 LLPSYDSSKPTASSSRQAREAWIKAKYVERRFSVKEPQIK  536 (785)
T ss_pred             ccccccccCCCCccchhhhhHhhhcccceeeEeecccchh
Confidence            98632        235569999999999999998865444


No 12 
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]
Probab=99.85  E-value=5.2e-22  Score=190.30  Aligned_cols=106  Identities=37%  Similarity=0.735  Sum_probs=94.2

Q ss_pred             hhcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHHhcCC
Q 041407            5 LLKLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWEAELP   84 (241)
Q Consensus         5 L~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wEa~lP   84 (241)
                      +.+...-++|+|||+++|.|||++-|+|+|.+|..+||.||.|||.||++....|.++.|+++..+.|..+|.+||..|=
T Consensus         2 ~k~~l~~evC~DC~~~dp~WASvnrGt~lC~eCcsvHrsLGrhIS~vrhLR~s~W~pt~l~~V~tLn~~gaNsIWEh~Ll   81 (669)
T KOG0818|consen    2 SKRLLSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLRHTPWPPTLLQMVETLNNNGANSIWEHSLL   81 (669)
T ss_pred             cccchhhhhhcccCCCCCcceeecCceEehHhhhHHHhhhcchHHHHHHhccCCCCHHHHHHHHHHHhcCcchhhhhhcc
Confidence            34566778999999999999999999999999999999999999999999999999999999999999999999999862


Q ss_pred             CC------------CCh--HHHHHHHHHHHhcCccccCCC
Q 041407           85 PN------------FDR--SRIEKFIRTKYEERKWVQKGA  110 (241)
Q Consensus        85 ~~------------~d~--~~re~fIraKYv~K~F~~~~~  110 (241)
                      +.            .|.  +.+++||++||+...|+.+..
T Consensus        82 d~st~~sg~rk~~pqD~~Hp~K~eFIkaKy~~LtFv~~~~  121 (669)
T KOG0818|consen   82 DPATIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLP  121 (669)
T ss_pred             CchhhhcccCCCCCcCCCCccHHHHHHHHHHheeeeccCC
Confidence            21            111  249999999999999999543


No 13 
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton]
Probab=99.76  E-value=2.6e-19  Score=179.69  Aligned_cols=103  Identities=48%  Similarity=0.888  Sum_probs=95.1

Q ss_pred             cCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcCCCccceeeecccCC--CChHHHHHHHhhCcHHHHHHHHhcCC
Q 041407            7 KLPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDT--WLPEQVAFMQSMGNEKSNKFWEAELP   84 (241)
Q Consensus         7 ~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~--Ws~~el~~mk~~GN~~aN~~wEa~lP   84 (241)
                      ....|+.|+|||++.|.||++|+++.||-.|+|.||+||..+|+|+|++||.  |+.+.++++..+||.++|+||-+++|
T Consensus       294 ~ne~nr~cadC~ssrPdwasiNL~vvIck~caGqhrslgs~dSkvrslkmd~svwsneliElfivlgn~~an~Fwa~nl~  373 (1186)
T KOG1117|consen  294 LNEENRECADCGSSRPDWASINLCVVICKPCAGQHRSLGSGDSKVRSLKMDPSVWSNELIELFIVLGNPRANRFWAGNLP  373 (1186)
T ss_pred             hccccccccccCCCCCcccccccceEEcccCCCccccCCCccccccccccCcccccchhhhhheeecCcccccccccCCC
Confidence            4678999999999999999999999999999999999999999999999995  99999999999999999999999998


Q ss_pred             CCC------ChHHHHHHHHHHHhcCccccCC
Q 041407           85 PNF------DRSRIEKFIRTKYEERKWVQKG  109 (241)
Q Consensus        85 ~~~------d~~~re~fIraKYv~K~F~~~~  109 (241)
                      ++.      ....|++||.+||.+.+|....
T Consensus       374 ~~e~lh~dssp~~r~~fi~~Kykeg~fRk~~  404 (1186)
T KOG1117|consen  374 PNEHLHPDSSPSTRRQFIKEKYKEGKFRKEH  404 (1186)
T ss_pred             CccccCCCCCcchhhhHHHHHhhcccccccc
Confidence            753      3446999999999999987653


No 14 
>KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=99.59  E-value=1e-15  Score=146.89  Aligned_cols=109  Identities=29%  Similarity=0.644  Sum_probs=100.5

Q ss_pred             ChHhhhcCCCCCCCcCCCCCCC-CeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHH
Q 041407            1 ILEGLLKLPENRECADCGSKAP-RWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFW   79 (241)
Q Consensus         1 il~~L~~~pgN~~CaDCgs~~P-~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~w   79 (241)
                      +||.|+++|+|++|++|.+..+ +|+++..|-|||..|+|.-|.|.. -+|||++.|..++..|+..++.+||+.+.++|
T Consensus        15 ~iR~l~kLP~NrrC~nCnsl~~~t~~~~~~g~fv~~~~sg~ls~l~~-ahRvksiSmttft~qevs~lQshgNq~~k~i~   93 (524)
T KOG0702|consen   15 EIRRLLKLPENRRCINCNSLVAATYVVYTVGSFVCTMCSGLLSGLNP-AHRVKSISMTTFTDQEVSFLQSHGNQVCKEIW   93 (524)
T ss_pred             HHHHHhcCCCCCceeeccccccceEEEeeccceeeeccchhhccCCC-ccccceeeeeeccccchHHHhhcchhhhhhhh
Confidence            5899999999999999999887 999999999999999999999865 57999999999999999999999999999999


Q ss_pred             Hhc-------CCCCCChHHHHHHHHHHHhcCccccCCC
Q 041407           80 EAE-------LPPNFDRSRIEKFIRTKYEERKWVQKGA  110 (241)
Q Consensus        80 Ea~-------lP~~~d~~~re~fIraKYv~K~F~~~~~  110 (241)
                      .+.       .|+..+....++||+.||+.|+|+.+..
T Consensus        94 fkl~D~q~S~vPD~rn~~~~kef~q~~y~~kr~~v~~n  131 (524)
T KOG0702|consen   94 FKLFDFQRSNVPDSRNPQKVKEFQQEKYVKKRYYVPKN  131 (524)
T ss_pred             hcchhhhhccCCCcccchhhHHHHhhhhccceeecCcc
Confidence            874       4677777889999999999999998754


No 15 
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]
Probab=93.03  E-value=0.022  Score=59.26  Aligned_cols=73  Identities=19%  Similarity=0.228  Sum_probs=60.8

Q ss_pred             cCCCCCCCcCCCCC-CCCeeEcccceeeehhchhhhhcCCCccceeeecccCCCChHHHHHHHhhCcHHHHHHHHh
Q 041407            7 KLPENRECADCGSK-APRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQVAFMQSMGNEKSNKFWEA   81 (241)
Q Consensus         7 ~~pgN~~CaDCgs~-~P~was~n~GifvC~~CsgiHR~LG~hiSkVKSl~lD~Ws~~el~~mk~~GN~~aN~~wEa   81 (241)
                      ..-.+..|++|++. ...|+++++.+-+|+.|+++|+.++.+.+...++.|++..+  +.+.-.-|+..++..+..
T Consensus       626 ~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~s~lh~a~~~~~~~~~e~ll~~ga~--vn~~d~~g~~plh~~~~~  699 (785)
T KOG0521|consen  626 KASSDGECLPRIATALAHGCCENWPVVLCIGCSLLHVAVGTGDSGAVELLLQNGAD--VNALDSKGRTPLHHATAS  699 (785)
T ss_pred             HhccCccchhhhhhhhcchhhhccchhhhcccchhhhhhccchHHHHHHHHhcCCc--chhhhccCCCcchhhhhh
Confidence            34457889999874 68899999999999999999999999999999999888776  777777777777766654


No 16 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=81.29  E-value=1.6  Score=28.15  Aligned_cols=34  Identities=12%  Similarity=0.346  Sum_probs=29.2

Q ss_pred             CCCCCcCCCCCCCCeeEcccceeeehhchhh-hhc
Q 041407           10 ENRECADCGSKAPRWASVNLGIFICMQCSGI-HRS   43 (241)
Q Consensus        10 gN~~CaDCgs~~P~was~n~GifvC~~Csgi-HR~   43 (241)
                      .+..|..|+.....+-+.+-+.++|..|... |+.
T Consensus         2 ~~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~   36 (42)
T PF00643_consen    2 QEPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG   36 (42)
T ss_dssp             SSSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT
T ss_pred             cCccCccCCccceEEEecCCCCccCccCCCCCCCC
Confidence            3578999998888999999999999999998 876


No 17 
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=79.54  E-value=1.1  Score=39.32  Aligned_cols=36  Identities=28%  Similarity=0.470  Sum_probs=29.1

Q ss_pred             HhhhcCCCCCCCcCCCCCCC-CeeEcccceeeehhch
Q 041407            3 EGLLKLPENRECADCGSKAP-RWASVNLGIFICMQCS   38 (241)
Q Consensus         3 ~~L~~~pgN~~CaDCgs~~P-~was~n~GifvC~~Cs   38 (241)
                      ..+--.|.-..|+-||.+.. .|.+..-|.++|..|.
T Consensus       141 ~~~G~~p~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        141 AELGYGLDLDHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             HHcCCccchhhHhcCCCCCCceEEecccCCccccccc
Confidence            33445667789999998754 7889999999999997


No 18 
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=70.23  E-value=3.2  Score=36.29  Aligned_cols=38  Identities=32%  Similarity=0.469  Sum_probs=29.7

Q ss_pred             HhhhcCCCCCCCcCCCCCCC-CeeEcccceeeehhchhh
Q 041407            3 EGLLKLPENRECADCGSKAP-RWASVNLGIFICMQCSGI   40 (241)
Q Consensus         3 ~~L~~~pgN~~CaDCgs~~P-~was~n~GifvC~~Csgi   40 (241)
                      ..+-=.|.-..|+.||..++ .+.+...|.++|..|...
T Consensus       139 ~~~G~~p~l~~C~~cg~~~~~~~fs~~~gg~~C~~c~~~  177 (241)
T TIGR00613       139 QILGYALDLDKCAVCGSKEDLIYFSMTYGGALCRQCGEK  177 (241)
T ss_pred             HHcCCCcccCccCCCCCcCCCceEchhcCeEEChhhCcc
Confidence            34445677789999998544 678999999999999764


No 19 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=70.12  E-value=2.6  Score=27.75  Aligned_cols=27  Identities=30%  Similarity=0.719  Sum_probs=20.9

Q ss_pred             CCcCCCCCCCCeeEcccceeeehhchhh
Q 041407           13 ECADCGSKAPRWASVNLGIFICMQCSGI   40 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC~~Csgi   40 (241)
                      +|-.||+.. .-..-.-|-++|..|..|
T Consensus         2 ~Cp~Cg~~~-~~~D~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDPERGELVCPNCGLV   28 (43)
T ss_dssp             SBTTTSSSE-EEEETTTTEEEETTT-BB
T ss_pred             CCcCCcCCc-eEEcCCCCeEECCCCCCE
Confidence            689999977 455677899999999544


No 20 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=63.51  E-value=2.4  Score=27.35  Aligned_cols=27  Identities=22%  Similarity=0.717  Sum_probs=16.7

Q ss_pred             CCCcCCCCC-CCCeeEcccceeeehhch
Q 041407           12 RECADCGSK-APRWASVNLGIFICMQCS   38 (241)
Q Consensus        12 ~~CaDCgs~-~P~was~n~GifvC~~Cs   38 (241)
                      ..|.+|+.+ .-+|..-+|+.-||..|.
T Consensus         4 ~~C~eC~~~f~dSyL~~~F~~~VCD~CR   31 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLLNNFDLPVCDKCR   31 (34)
T ss_dssp             EE-TTT--EES-SSCCCCTS-S--TTT-
T ss_pred             chHhHhCCHHHHHHHHHhCCcccccccc
Confidence            479999987 677999999999999994


No 21 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=63.36  E-value=6  Score=25.58  Aligned_cols=27  Identities=33%  Similarity=0.923  Sum_probs=22.8

Q ss_pred             CCCCCcCCCCCCCCeeEcccceeeehhchh
Q 041407           10 ENRECADCGSKAPRWASVNLGIFICMQCSG   39 (241)
Q Consensus        10 gN~~CaDCgs~~P~was~n~GifvC~~Csg   39 (241)
                      .|..|..|++.   |....=|-+.|..|..
T Consensus         7 ~~~~C~~C~~~---~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    7 PNEPCPVCGSR---WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CCCcCCCCCCe---EeEccCCEEEhhhCce
Confidence            45679999997   8889999999999943


No 22 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=55.55  E-value=13  Score=25.69  Aligned_cols=37  Identities=27%  Similarity=0.680  Sum_probs=30.2

Q ss_pred             CCCCCcCCCCC-CCCeeEcccce-eeehhchhhhhcCCC
Q 041407           10 ENRECADCGSK-APRWASVNLGI-FICMQCSGIHRSLGV   46 (241)
Q Consensus        10 gN~~CaDCgs~-~P~was~n~Gi-fvC~~CsgiHR~LG~   46 (241)
                      ....|..|+.. .|.|=.-..|- ++|-.|.-..+..|.
T Consensus         2 ~~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~   40 (52)
T smart00401        2 SGRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGG   40 (52)
T ss_pred             CCCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCC
Confidence            45789999975 68898888886 999999887777654


No 23 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=54.31  E-value=11  Score=24.10  Aligned_cols=32  Identities=28%  Similarity=0.801  Sum_probs=23.2

Q ss_pred             CcCCCCC-CCCeeEccccee-eehhchhhhhcCC
Q 041407           14 CADCGSK-APRWASVNLGIF-ICMQCSGIHRSLG   45 (241)
Q Consensus        14 CaDCgs~-~P~was~n~Gif-vC~~CsgiHR~LG   45 (241)
                      |..|+.. .|.|=....|-. ||-.|.-.+|..|
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~   34 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYG   34 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhC
Confidence            8899976 799998888888 9999987776544


No 24 
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain. Outspread Pleckstrin homology (PH) domain. Outspread contains two PH domains and a C-terminal coiled-coil region. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=53.33  E-value=5.3  Score=31.53  Aligned_cols=62  Identities=16%  Similarity=0.087  Sum_probs=39.8

Q ss_pred             hcCCCCcccccchhHHHhhhhhhccCCCCCCCCCCCCCccccccCCCCCCCCCCCCceeEeeccCC
Q 041407          132 KRGIPRKTRTLSLEEEILTKHIAQIAPPPTVGRSRGGSLDMNEKAAAPIPPRVPPSVAEVQVPTNN  197 (241)
Q Consensus       132 k~~~~~k~r~l~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (241)
                      .....+|.|+..|.+..+   + .+.........+-|+|||++...+.....+-+..++|.+.||.
T Consensus        19 ~~~K~WkrRWFvL~~~~~---L-~y~~d~~~~~~p~G~IdL~~~~~V~~~~~~~~~~~~f~I~tp~   80 (104)
T cd01236          19 HRSKRWQRRWFILYDHGL---L-TYALDEMPTTLPQGTIDMNQCTDVVDAEARTGQKFSICILTPD   80 (104)
T ss_pred             eeeccccceEEEEeCCCE---E-EEeeCCCCCcccceEEEccceEEEeecccccCCccEEEEECCC
Confidence            345678899999964322   2 3432221345666999999988776555555556778777664


No 25 
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=52.30  E-value=6.7  Score=35.32  Aligned_cols=35  Identities=34%  Similarity=0.696  Sum_probs=28.5

Q ss_pred             hhhcCCCCCCCcCCCCCC-CCeeEcccceeeehhch
Q 041407            4 GLLKLPENRECADCGSKA-PRWASVNLGIFICMQCS   38 (241)
Q Consensus         4 ~L~~~pgN~~CaDCgs~~-P~was~n~GifvC~~Cs   38 (241)
                      .+-=.|.=..|+.||.+. |...+.-.|-++|..|+
T Consensus       147 ~~G~~~~l~~Ca~cg~~~~~~~~s~~~~~~~C~~~~  182 (251)
T COG1381         147 ELGIGPNLTSCARCGTPVDPVYFSPKSGGFLCSKCA  182 (251)
T ss_pred             HcCCccchHHHhCcCCcCCCcceeeccCcccchhcc
Confidence            333455567899999985 57999999999999998


No 26 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=51.33  E-value=11  Score=28.40  Aligned_cols=31  Identities=23%  Similarity=0.645  Sum_probs=26.2

Q ss_pred             CCCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           10 ENRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        10 gN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      +|..|.=||.+..   ...||+..|..|.+..|.
T Consensus         2 ~~~~C~VCg~~~~---g~hyGv~sC~aC~~FFRR   32 (82)
T cd07171           2 DTHFCAVCSDYAS---GYHYGVWSCEGCKAFFKR   32 (82)
T ss_pred             CCCCCeecCCcCc---ceEECceeehhhHHhHHH
Confidence            5778999998665   469999999999998875


No 27 
>cd01264 PH_melted Melted pleckstrin homology (PH) domain. Melted pleckstrin homology (PH) domain. The melted protein has a C-terminal PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=49.80  E-value=6.5  Score=31.01  Aligned_cols=58  Identities=14%  Similarity=0.114  Sum_probs=36.8

Q ss_pred             CCCcccccchhHHHhhhhhhccCCCCCCCCCCCCCccccccCCCCCCCCCC---CCceeEeeccCC
Q 041407          135 IPRKTRTLSLEEEILTKHIAQIAPPPTVGRSRGGSLDMNEKAAAPIPPRVP---PSVAEVQVPTNN  197 (241)
Q Consensus       135 ~~~k~r~l~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~---~~~~~~~~~~~~  197 (241)
                      ..++.|+..|....+    . +......+...-|+|||++...+.+..+..   +.+++|.+.||.
T Consensus        17 K~WkrRwF~L~~~~L----~-y~K~~~~~~~~~g~IdL~~~~sVk~~~~~~~~~~~~~~Fei~tp~   77 (101)
T cd01264          17 KRWKTRYFTLSGAQL----L-FQKGKSKDDPDDCSIDLSKIRSVKAVAKKRRDRSLPKAFEIFTAD   77 (101)
T ss_pred             ecceeEEEEEeCCEE----E-EEeccCccCCCCceEEcccceEEeeccccccccccCcEEEEEcCC
Confidence            356689999976533    3 333322333334899999999876554322   446899998764


No 28 
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha is a phophatidlyinositide binding protein consisting of an N-terminal ArfGAP domain and two PH domains. In response to growth factor activation, PI3K phosphorylates phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 1 is recruited to the plasma membrane following growth factor stimulation by specific binding of its PH domain to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 2 is constitutively bound to the plasma membrane since it binds phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate with equal affinity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specifici
Probab=47.97  E-value=14  Score=28.47  Aligned_cols=36  Identities=14%  Similarity=0.230  Sum_probs=24.8

Q ss_pred             CCCcccccchhHHHhhhhhhccCCCCCCCCCCCCCccccccC
Q 041407          135 IPRKTRTLSLEEEILTKHIAQIAPPPTVGRSRGGSLDMNEKA  176 (241)
Q Consensus       135 ~~~k~r~l~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~  176 (241)
                      ..+|.|+..|.+.    .+.++.-+  ....+.|+|+|..+.
T Consensus        14 k~wkkRwFvL~~~----~L~Yyk~~--~d~~~~G~I~L~~~~   49 (103)
T cd01251          14 EGFKKRWFTLDDR----RLMYFKDP--LDAFAKGEVFLGSQE   49 (103)
T ss_pred             CCceeEEEEEeCC----EEEEECCC--CCcCcCcEEEeeccc
Confidence            3478999999754    34444444  456788999998764


No 29 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=44.65  E-value=15  Score=27.75  Aligned_cols=31  Identities=23%  Similarity=0.652  Sum_probs=25.8

Q ss_pred             CCCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           10 ENRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        10 gN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ..+.|.=||.+..   ...||+..|..|.+..|.
T Consensus         2 ~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   32 (82)
T cd07173           2 PQKTCLICGDEAS---GCHYGALTCGSCKVFFKR   32 (82)
T ss_pred             CCCCCeecCCcCc---ceEECcchhhhHHHHHHH
Confidence            4567999998765   458999999999998875


No 30 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=43.01  E-value=18  Score=28.08  Aligned_cols=32  Identities=31%  Similarity=0.750  Sum_probs=26.5

Q ss_pred             CCCCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407            9 PENRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus         9 pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ..+..|.=||.+...   ..||+..|..|.+..|.
T Consensus         3 ~~~~~C~VCg~~~~g---~hyGv~sC~aC~~FFRR   34 (95)
T cd06968           3 IEVIPCKICGDKSSG---IHYGVITCEGCKGFFRR   34 (95)
T ss_pred             ccccCCcccCCcCcc---eEECceeehhhHHhhHH
Confidence            356789999987654   58999999999999875


No 31 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=42.65  E-value=18  Score=28.48  Aligned_cols=31  Identities=32%  Similarity=0.788  Sum_probs=26.1

Q ss_pred             CCCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           10 ENRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        10 gN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ++..|.=||.+..   ...||+..|..|.+..|.
T Consensus        17 ~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   47 (101)
T cd07160          17 GNEVCSVCGDKAS---GFHYNVLSCEGCKGFFRR   47 (101)
T ss_pred             CCCCCeecCCcCc---ceEECcceehhhhhhhhh
Confidence            5678999998765   459999999999998875


No 32 
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=41.78  E-value=18  Score=28.26  Aligned_cols=30  Identities=27%  Similarity=0.670  Sum_probs=24.8

Q ss_pred             CCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           11 NRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        11 N~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      +..|.=||.+..   ...||+..|..|.+..|.
T Consensus         4 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   33 (97)
T cd07170           4 KRLCLVCGDIAS---GYHYGVASCEACKAFFKR   33 (97)
T ss_pred             CCCCeecCCcCc---ceEECceeehhhhHHHHH
Confidence            357999998765   458999999999999875


No 33 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=41.25  E-value=11  Score=24.16  Aligned_cols=30  Identities=23%  Similarity=0.527  Sum_probs=15.1

Q ss_pred             CCCcCCCCCCCCeeEc---ccceeeehhchhhhh
Q 041407           12 RECADCGSKAPRWASV---NLGIFICMQCSGIHR   42 (241)
Q Consensus        12 ~~CaDCgs~~P~was~---n~GifvC~~CsgiHR   42 (241)
                      +.|-.||.+ .++...   +.-=++|..|.-||-
T Consensus         1 kfC~~CG~~-l~~~ip~gd~r~R~vC~~Cg~IhY   33 (34)
T PF14803_consen    1 KFCPQCGGP-LERRIPEGDDRERLVCPACGFIHY   33 (34)
T ss_dssp             -B-TTT--B--EEE--TT-SS-EEEETTTTEEE-
T ss_pred             CccccccCh-hhhhcCCCCCccceECCCCCCEEe
Confidence            468889886 222222   445578999988883


No 34 
>PRK12495 hypothetical protein; Provisional
Probab=41.08  E-value=17  Score=32.75  Aligned_cols=30  Identities=27%  Similarity=0.507  Sum_probs=24.4

Q ss_pred             cCCCCCCCcCCCCCCCCeeEcccceeeehhchhh
Q 041407            7 KLPENRECADCGSKAPRWASVNLGIFICMQCSGI   40 (241)
Q Consensus         7 ~~pgN~~CaDCgs~~P~was~n~GifvC~~Csgi   40 (241)
                      ....+..|-+||.+=|..    -|+.+|..|..+
T Consensus        38 atmsa~hC~~CG~PIpa~----pG~~~Cp~CQ~~   67 (226)
T PRK12495         38 ATMTNAHCDECGDPIFRH----DGQEFCPTCQQP   67 (226)
T ss_pred             cccchhhcccccCcccCC----CCeeECCCCCCc
Confidence            356789999999998832    699999999754


No 35 
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. CNK is believed to regulate the activity and the subcellular localization of RAS activated RAF. CNK is composed of N-terminal SAM and PDZ domains along with a central or C-terminal PH domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskelet
Probab=39.16  E-value=11  Score=28.11  Aligned_cols=54  Identities=11%  Similarity=-0.025  Sum_probs=36.2

Q ss_pred             CCcccccchhHHHhhhhhhccCCCCCCCCCCCCCccccccCCCCCCCCCCCCceeEeeccCC
Q 041407          136 PRKTRTLSLEEEILTKHIAQIAPPPTVGRSRGGSLDMNEKAAAPIPPRVPPSVAEVQVPTNN  197 (241)
Q Consensus       136 ~~k~r~l~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (241)
                      .++.|+..|.+..+     .+...+ ....+.|.|+|.... +..+.+.. +.++|.+.+++
T Consensus        19 ~WkkrwfvL~~~~L-----~yyk~~-~~~~~~~~I~L~~~~-v~~~~~~~-k~~~F~I~~~~   72 (96)
T cd01260          19 KWARRWFVLKGTTL-----YWYRSK-QDEKAEGLIFLSGFT-IESAKEVK-KKYAFKVCHPV   72 (96)
T ss_pred             CceeEEEEEECCEE-----EEECCC-CCCccceEEEccCCE-EEEchhcC-CceEEEECCCC
Confidence            78899999976533     444443 556678999998753 32333333 77899997654


No 36 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=38.38  E-value=23  Score=32.82  Aligned_cols=35  Identities=23%  Similarity=0.509  Sum_probs=24.9

Q ss_pred             cCCCCCCCcCCCCCCCCeeEcccceeeehhchhhhh
Q 041407            7 KLPENRECADCGSKAPRWASVNLGIFICMQCSGIHR   42 (241)
Q Consensus         7 ~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR   42 (241)
                      .......|.+||+... =....-|-.||.+|.-|..
T Consensus         7 ~~~~~~~Cp~Cg~~~i-v~d~~~Ge~vC~~CG~Vl~   41 (310)
T PRK00423          7 EEEEKLVCPECGSDKL-IYDYERGEIVCADCGLVIE   41 (310)
T ss_pred             hcccCCcCcCCCCCCe-eEECCCCeEeecccCCccc
Confidence            3445578999997432 2345779999999988653


No 37 
>TIGR02419 C4_traR_proteo phage/conjugal plasmid C-4 type zinc finger protein, TraR family. Members of this family are putative C4-type zinc finger proteins found almost exclusively in prophage regions, actual phage, or conjugal transfer regions of the Proteobactia. This small protein (about 70 amino acids) appears homologous to but is smaller than DksA (DnaK suppressor protein), found to be critical for regulating transcription of ribosomal RNA.
Probab=38.32  E-value=9.2  Score=27.56  Aligned_cols=35  Identities=34%  Similarity=0.666  Sum_probs=23.2

Q ss_pred             cCCCCCCCcCCCCCCCCee-Ecccceeeehhchhhh
Q 041407            7 KLPENRECADCGSKAPRWA-SVNLGIFICMQCSGIH   41 (241)
Q Consensus         7 ~~pgN~~CaDCgs~~P~wa-s~n~GifvC~~CsgiH   41 (241)
                      ..++...|.|||.+=|.=- -.--|+..|+.|...+
T Consensus        27 ~~~s~g~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~~~   62 (63)
T TIGR02419        27 IGPSLRECEDCGEPIPEARREALPGVTRCVSCQEIL   62 (63)
T ss_pred             cCCCCCeeccCCCcChHHHHhhcCCcCCcHHHHhhc
Confidence            4566789999998744211 1234778899997654


No 38 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=35.46  E-value=19  Score=27.88  Aligned_cols=29  Identities=31%  Similarity=0.712  Sum_probs=23.7

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      +.|.=||.+...   ..||+..|..|.+..|.
T Consensus         1 ~~C~VCg~~a~g---~hyGv~sC~aC~~FFRR   29 (94)
T cd06966           1 KICGVCGDKALG---YNFNAITCESCKAFFRR   29 (94)
T ss_pred             CCCeeCCCcCcc---eEECcceeeeehheehh
Confidence            358889886654   48999999999998875


No 39 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=34.02  E-value=26  Score=24.80  Aligned_cols=27  Identities=22%  Similarity=0.685  Sum_probs=22.4

Q ss_pred             CCCCcCCCCCCCCeeEcccceeeehhchh
Q 041407           11 NRECADCGSKAPRWASVNLGIFICMQCSG   39 (241)
Q Consensus        11 N~~CaDCgs~~P~was~n~GifvC~~Csg   39 (241)
                      -+.|..||.....  ..+-.+|.|..|.-
T Consensus        28 Sq~C~~CG~~~~~--~~~~r~~~C~~Cg~   54 (69)
T PF07282_consen   28 SQTCPRCGHRNKK--RRSGRVFTCPNCGF   54 (69)
T ss_pred             ccCccCccccccc--ccccceEEcCCCCC
Confidence            4789999998877  77888999999844


No 40 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=33.74  E-value=30  Score=26.63  Aligned_cols=29  Identities=28%  Similarity=0.721  Sum_probs=23.7

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ..|.=||.+..   ...||++.|..|.+..|.
T Consensus         2 ~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   30 (91)
T cd07161           2 ELCLVCGDRAS---GYHYNALTCEGCKGFFRR   30 (91)
T ss_pred             CCCeeCCCcCc---ceEECceeehhhHHHHHH
Confidence            35888998766   459999999999998875


No 41 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=32.66  E-value=31  Score=26.46  Aligned_cols=32  Identities=34%  Similarity=0.862  Sum_probs=26.3

Q ss_pred             CCCCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407            9 PENRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus         9 pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      .++..|.=||.+..   ...||+..|..|.+..|.
T Consensus         4 ~~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (90)
T cd07169           4 AEQRTCLICGDRAT---GLHYGIISCEGCKGFFKR   35 (90)
T ss_pred             ccCCCCeecCCcCc---ceEECcceehhhHHHHHH
Confidence            45678999998665   458999999999998875


No 42 
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=32.64  E-value=31  Score=25.70  Aligned_cols=29  Identities=21%  Similarity=0.649  Sum_probs=23.9

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ..|.=||.+..   ...||+..|..|.+..|.
T Consensus         3 ~~C~VCg~~a~---g~hyGv~sC~aC~~FFRR   31 (78)
T cd07172           3 KICLVCSDEAS---GCHYGVLTCGSCKVFFKR   31 (78)
T ss_pred             CCCeecCCcCc---ceEECceeehhhHHhHHH
Confidence            46888998665   459999999999998875


No 43 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=32.57  E-value=6.3  Score=24.98  Aligned_cols=29  Identities=28%  Similarity=0.696  Sum_probs=16.0

Q ss_pred             CCcCCCCCCCC-eeEcccceeeehhchhhh
Q 041407           13 ECADCGSKAPR-WASVNLGIFICMQCSGIH   41 (241)
Q Consensus        13 ~CaDCgs~~P~-was~n~GifvC~~CsgiH   41 (241)
                      .|.+||.+=|. =.-+--+..+|..|+..|
T Consensus         5 ~C~~CGe~I~~~Rl~~~p~~~~C~~C~~~~   34 (36)
T PF01258_consen    5 ICEDCGEPIPEERLVAVPGATLCVECQERR   34 (36)
T ss_dssp             B-TTTSSBEEHHHHHHCTTECS-HHHHHHH
T ss_pred             CccccCChHHHHHHHhCCCcEECHHHhCcc
Confidence            48999975221 111223777899998765


No 44 
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain. Tec pleckstrin homology (PH) domain. Proteins in the Tec family of cytoplasmic protein tyrosine kinases that includes Bruton's tyrosine kinase (BTK), BMX, IL2-inducible T-cell kinase (Itk) and Tec. These proteins generally have an N-terminal PH domain, followed by a Tek homology (TH) domain, a SH3 domain, a SH2 domain and a kinase domain. Tec PH domains tether these proteins to membranes following the activation of PI3K and its subsequent phosphorylation of phosphoinositides. The importance of PH domain membrane anchoring is confirmed by the discovery of a mutation of a critical arginine residue in the BTK PH domain, which causes X-linked agammaglobulinemia (XLA) in humans and a related disorder is mice. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few dis
Probab=32.53  E-value=20  Score=27.87  Aligned_cols=58  Identities=16%  Similarity=0.114  Sum_probs=34.2

Q ss_pred             CCCcccccchhHHHhhhhhhccCCCCCCCCCCCCCccccccCCCCCCCCCC------CCceeEeeccC
Q 041407          135 IPRKTRTLSLEEEILTKHIAQIAPPPTVGRSRGGSLDMNEKAAAPIPPRVP------PSVAEVQVPTN  196 (241)
Q Consensus       135 ~~~k~r~l~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~------~~~~~~~~~~~  196 (241)
                      ..+|.|+..|++.    .+.++...+.....+-|+|||.....+....+..      ...++|.+-|+
T Consensus        19 ~nwKkRwFvL~~~----~L~Yyk~~~~~~~~~kG~I~L~~~~~ve~~~~~~~~~~~~~~~~~F~i~t~   82 (106)
T cd01238          19 LNYKERLFVLTKS----KLSYYEGDFEKRGSKKGSIDLSKIKCVETVKPEKNPPIPERFKYPFQVVHD   82 (106)
T ss_pred             CCceeEEEEEcCC----EEEEECCCcccccCcceeEECCcceEEEEecCCcCcccccccCccEEEEeC
Confidence            3788999999754    3455555432234566999999875543222221      13466766553


No 45 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=32.00  E-value=34  Score=26.65  Aligned_cols=32  Identities=22%  Similarity=0.580  Sum_probs=24.5

Q ss_pred             cCCCCCCCcCCCCCCCCeeEcccceeeehhchhh
Q 041407            7 KLPENRECADCGSKAPRWASVNLGIFICMQCSGI   40 (241)
Q Consensus         7 ~~pgN~~CaDCgs~~P~was~n~GifvC~~Csgi   40 (241)
                      +...--.|-.|+.+  .---+..||+.|..|...
T Consensus        31 ~~~~~~~Cp~C~~~--~VkR~a~GIW~C~kCg~~   62 (89)
T COG1997          31 QQRAKHVCPFCGRT--TVKRIATGIWKCRKCGAK   62 (89)
T ss_pred             HHhcCCcCCCCCCc--ceeeeccCeEEcCCCCCe
Confidence            33455689999998  455678999999999653


No 46 
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=31.94  E-value=24  Score=25.64  Aligned_cols=23  Identities=26%  Similarity=0.702  Sum_probs=14.3

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhc
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQC   37 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~C   37 (241)
                      -+|+|||+.+.   --.--++-|-+|
T Consensus        21 YiCgdC~~en~---lk~~D~irCReC   43 (62)
T KOG3507|consen   21 YICGDCGQENT---LKRGDVIRCREC   43 (62)
T ss_pred             EEecccccccc---ccCCCcEehhhc
Confidence            36888888754   112345677777


No 47 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=31.79  E-value=33  Score=26.06  Aligned_cols=28  Identities=29%  Similarity=0.749  Sum_probs=22.8

Q ss_pred             CCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           13 ECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      .|.=||.+...   ..||+..|..|++..|.
T Consensus         1 ~C~VCg~~~~g---~hygv~sC~aC~~FFRR   28 (87)
T cd07162           1 ICRVCGDRATG---YHFNAMTCEGCKGFFRR   28 (87)
T ss_pred             CCcccCCcCcc---eEECcceehhhHHHHHh
Confidence            37778877664   48999999999998875


No 48 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=30.06  E-value=30  Score=23.55  Aligned_cols=26  Identities=31%  Similarity=0.744  Sum_probs=19.2

Q ss_pred             CCcCCCCCCCCeeEcccceeeehhchh
Q 041407           13 ECADCGSKAPRWASVNLGIFICMQCSG   39 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC~~Csg   39 (241)
                      .|.=|+...+. .-.=+|.|+|.+|-.
T Consensus         1 ~CiiC~~~~~~-GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEE-GIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCC-CEEEECeEehHHHHH
Confidence            47778887766 344579999999954


No 49 
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=30.03  E-value=39  Score=25.00  Aligned_cols=28  Identities=32%  Similarity=0.870  Sum_probs=23.1

Q ss_pred             CCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           13 ECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      .|.=||.+...   ..||+..|..|.+..|.
T Consensus         2 ~C~VC~~~~~g---~hygv~sC~aC~~FFRR   29 (77)
T cd06956           2 ICAICGDRASG---KHYGVYSCEGCKGFFKR   29 (77)
T ss_pred             CCcccCCcCcc---eEECceeehhHHHHHHH
Confidence            47788876654   59999999999998875


No 50 
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=29.89  E-value=23  Score=27.22  Aligned_cols=30  Identities=30%  Similarity=0.832  Sum_probs=25.4

Q ss_pred             CCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           11 NRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        11 N~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |..|.=||.+...   ..||+..|..|.+..|.
T Consensus         6 ~~~C~VCg~~a~g---~hyGv~sC~aCk~FFRR   35 (92)
T cd07163           6 DIPCKVCGDRSSG---KHYGIYACDGCSGFFKR   35 (92)
T ss_pred             CCCCcccCCcCcc---cEECceeeeeeeeEEee
Confidence            7789999987664   59999999999998875


No 51 
>PF04189 Gcd10p:  Gcd10p family;  InterPro: IPR007316 eIF-3 is a multisubunit complex that stimulates translation initiation in vitro at several different steps. This family corresponds to the gamma subunit of eIF3 [, ].; GO: 0003743 translation initiation factor activity, 0006413 translational initiation
Probab=29.69  E-value=49  Score=30.95  Aligned_cols=46  Identities=15%  Similarity=0.231  Sum_probs=28.5

Q ss_pred             CCCChHHHHHHHhhCcHHHHHHHHhcCCCCCChHHHHHHHHHHHhcC
Q 041407           57 DTWLPEQVAFMQSMGNEKSNKFWEAELPPNFDRSRIEKFIRTKYEER  103 (241)
Q Consensus        57 D~Ws~~el~~mk~~GN~~aN~~wEa~lP~~~d~~~re~fIraKYv~K  103 (241)
                      .+.+.+||+.|+.-|-. +.++-++-+-.+..-..|-+|=++||.+|
T Consensus       106 QkLt~eeIe~LK~~g~s-g~eII~kLiens~tF~~KT~FSqeKYlkr  151 (299)
T PF04189_consen  106 QKLTQEEIEELKKEGVS-GEEIIEKLIENSSTFDKKTEFSQEKYLKR  151 (299)
T ss_pred             ccCCHHHHHHHHHcCCC-HHHHHHHHHHhccchhhhhHHHHHHHHHH
Confidence            34778999999987544 55555554433333344667777777653


No 52 
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain. PARIS-1 pleckstrin homology (PH) domain. PARIS-1 contains a  PH domain and a TBC-type GTPase catalytic domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=28.99  E-value=30  Score=26.24  Aligned_cols=55  Identities=15%  Similarity=0.175  Sum_probs=33.3

Q ss_pred             CCCcccccchhHHHhhhhhhccCCCCCCCCCCCCCccccccCCCCCCCCCCCCceeEeeccC
Q 041407          135 IPRKTRTLSLEEEILTKHIAQIAPPPTVGRSRGGSLDMNEKAAAPIPPRVPPSVAEVQVPTN  196 (241)
Q Consensus       135 ~~~k~r~l~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~  196 (241)
                      ..++.|+..|++..  ..+..+..+  .+..+-|+|||.....+..+.+   ....|.+.|+
T Consensus        15 K~WkkRWFvL~~~~--~~L~Yyk~~--~d~~p~G~I~L~~~~~~~~~~~---~~~~F~i~t~   69 (95)
T cd01265          15 RGRRSRWFALDDRT--CYLYYYKDS--QDAKPLGRVDLSGAAFTYDPRE---EKGRFEIHSN   69 (95)
T ss_pred             cCceeEEEEEcCCC--cEEEEECCC--CcccccceEECCccEEEcCCCC---CCCEEEEEcC
Confidence            46779999996431  124455444  5667889999998654422222   2356776654


No 53 
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs. This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive.
Probab=28.84  E-value=32  Score=28.73  Aligned_cols=28  Identities=25%  Similarity=0.743  Sum_probs=20.5

Q ss_pred             CCCCCCCcCCCCCCCCeeEcccceeeehhchhhhhcC
Q 041407            8 LPENRECADCGSKAPRWASVNLGIFICMQCSGIHRSL   44 (241)
Q Consensus         8 ~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~L   44 (241)
                      ..+...|.-||.  .+|+       +|..|.|-|+.+
T Consensus        96 ~~~~~~C~~Cgg--~rfv-------~C~~C~Gs~k~~  123 (147)
T cd03031          96 RAGGGVCEGCGG--ARFV-------PCSECNGSCKVF  123 (147)
T ss_pred             ccCCCCCCCCCC--cCeE-------ECCCCCCcceEE
Confidence            345567888884  3454       999999999874


No 54 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=28.81  E-value=47  Score=22.01  Aligned_cols=32  Identities=25%  Similarity=0.642  Sum_probs=24.1

Q ss_pred             hcCCCCCCCcCCCCCCCCeeEcccceeeehhch
Q 041407            6 LKLPENRECADCGSKAPRWASVNLGIFICMQCS   38 (241)
Q Consensus         6 ~~~pgN~~CaDCgs~~P~was~n~GifvC~~Cs   38 (241)
                      ++.|+.-+|.-||+....+. -+.+.+-|-.|.
T Consensus        13 ~RW~~g~~CP~Cg~~~~~~~-~~~~~~~C~~C~   44 (46)
T PF12760_consen   13 IRWPDGFVCPHCGSTKHYRL-KTRGRYRCKACR   44 (46)
T ss_pred             hcCCCCCCCCCCCCeeeEEe-CCCCeEECCCCC
Confidence            46777789999999855443 336999999884


No 55 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=28.42  E-value=33  Score=24.99  Aligned_cols=27  Identities=37%  Similarity=0.901  Sum_probs=21.3

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+...   ..||++.|..|.+..|.
T Consensus         1 C~VCg~~~~g---~hyGv~~C~aC~~FFRR   27 (73)
T cd07158           1 CKVCGDKASG---FHYGVHSCEGCKGFFRR   27 (73)
T ss_pred             CcccCccCcc---eEECcchhhHHHHHHhh
Confidence            5557766553   58999999999999875


No 56 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=28.05  E-value=26  Score=26.46  Aligned_cols=27  Identities=37%  Similarity=0.910  Sum_probs=22.2

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.....   ..||++.|..|.+..|.
T Consensus         2 C~VCg~~~~g---~hyGv~sC~aCk~FFRR   28 (84)
T cd06965           2 CRVCGDKASG---FHYGVHACEGCKGFFRR   28 (84)
T ss_pred             CcccCccCcc---eEEChhhhhhhhhheee
Confidence            7778876654   47999999999999875


No 57 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=27.84  E-value=37  Score=24.75  Aligned_cols=27  Identities=30%  Similarity=0.823  Sum_probs=21.3

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+...   ..||+..|..|.+..|.
T Consensus         1 C~VC~~~~~g---~hygv~sC~aC~~FFRR   27 (72)
T cd07156           1 CGVCGDRATG---YHFNAMTCEGCKGFFRR   27 (72)
T ss_pred             CCccCccCcc---cEECcceehhhhhhhch
Confidence            5557766654   48999999999998875


No 58 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=27.68  E-value=41  Score=24.67  Aligned_cols=27  Identities=26%  Similarity=0.762  Sum_probs=21.1

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+..   ...||++.|..|.+..|.
T Consensus         1 C~VCg~~a~---~~hygv~sC~aCk~FFRR   27 (73)
T cd06963           1 CLICGDEAS---GCHYGVLTCGSCKVFFKR   27 (73)
T ss_pred             CcccCccCc---ceEECceeehhhhHhHHH
Confidence            455776554   458999999999998875


No 59 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=27.24  E-value=24  Score=24.41  Aligned_cols=30  Identities=30%  Similarity=0.695  Sum_probs=19.5

Q ss_pred             CCcCCCCCCCCee--Ecccceeeehhchhhhhc
Q 041407           13 ECADCGSKAPRWA--SVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        13 ~CaDCgs~~P~wa--s~n~GifvC~~CsgiHR~   43 (241)
                      .|+=||..-.-.-  -+.=| +||.+|..--..
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl~~   32 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKLSG   32 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHhcC
Confidence            4788887644333  34557 899999864333


No 60 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=27.20  E-value=43  Score=24.59  Aligned_cols=27  Identities=33%  Similarity=0.898  Sum_probs=21.2

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+...   ..||+..|..|.+..|.
T Consensus         1 C~VCg~~~~g---~hygv~sC~aC~~FFRR   27 (74)
T cd07179           1 CRVCGGKSSG---FHFGALTCEGCKGFFRR   27 (74)
T ss_pred             CcccCccCcc---eEECceeehhHHHHHHH
Confidence            5557766553   58999999999998875


No 61 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=27.18  E-value=30  Score=27.56  Aligned_cols=30  Identities=30%  Similarity=0.767  Sum_probs=25.1

Q ss_pred             CCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           11 NRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        11 N~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ...|.=||.....   ..||+..|..|.+..|.
T Consensus         6 ~~~C~VCg~~a~g---~hyGv~sC~aCk~FFRR   35 (107)
T cd06955           6 PRICGVCGDRATG---FHFNAMTCEGCKGFFRR   35 (107)
T ss_pred             CCCCeecCCcCcc---cEECcceeeeecceecc
Confidence            3679999987664   59999999999998875


No 62 
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=26.47  E-value=31  Score=26.41  Aligned_cols=30  Identities=33%  Similarity=0.744  Sum_probs=24.6

Q ss_pred             CCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           11 NRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        11 N~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      +..|.=||.+...   ..||++.|..|.+..|.
T Consensus         3 ~~~C~VCg~~a~g---~hyGv~sC~aCk~FFRR   32 (89)
T cd07166           3 VVLCKVCGDKASG---FHYGVHACEGCKGFFRR   32 (89)
T ss_pred             CCCCcccCccCcc---eEEChhhhhhHhhEecc
Confidence            4569999987664   47999999999998875


No 63 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=26.32  E-value=44  Score=22.02  Aligned_cols=22  Identities=27%  Similarity=0.760  Sum_probs=15.9

Q ss_pred             CCcCCCCCCCCeeEcccceeee
Q 041407           13 ECADCGSKAPRWASVNLGIFIC   34 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC   34 (241)
                      +|.+|+..+.-|+++.-|-..|
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c   22 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGC   22 (50)
T ss_pred             CcccCCCcCCeEEecCCCCccc
Confidence            5999998877776666555555


No 64 
>COG1734 DksA DnaK suppressor protein [Signal transduction mechanisms]
Probab=26.17  E-value=13  Score=30.27  Aligned_cols=31  Identities=19%  Similarity=0.553  Sum_probs=20.0

Q ss_pred             CCCcCCCCCCC-CeeEcccceeeehhchhhhh
Q 041407           12 RECADCGSKAP-RWASVNLGIFICMQCSGIHR   42 (241)
Q Consensus        12 ~~CaDCgs~~P-~was~n~GifvC~~CsgiHR   42 (241)
                      ..|.+||.+=| .=.-.--+..+|+.|...|-
T Consensus        81 G~Ce~cG~~Ip~~RL~A~P~A~~Ci~cQ~~~E  112 (120)
T COG1734          81 GICEECGEPIPEARLEARPTARLCIECQERAE  112 (120)
T ss_pred             cchhccCCcCCHHHHhhCcchHHHHHHHHHHH
Confidence            37999998732 11122235678999988764


No 65 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=26.13  E-value=37  Score=25.40  Aligned_cols=27  Identities=37%  Similarity=0.877  Sum_probs=21.4

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         1 C~VCg~~~~---g~hyG~~sC~aC~~FFRR   27 (81)
T cd07165           1 CKVCGDKAS---GYHYGVTSCEGCKGFFRR   27 (81)
T ss_pred             CCccCccCc---ceEECchhhhhHHHHHHh
Confidence            555777655   359999999999998885


No 66 
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=26.12  E-value=47  Score=25.44  Aligned_cols=31  Identities=29%  Similarity=0.746  Sum_probs=25.2

Q ss_pred             CCCCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           10 ENRECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        10 gN~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ....|.=||.+..   ...||+..|..|.+..|.
T Consensus         5 ~~~~C~VCg~~~~---g~hyGv~sC~aCk~FFRR   35 (90)
T cd07168           5 SPKLCSICEDKAT---GLHYGIITCEGCKGFFKR   35 (90)
T ss_pred             cCCCCcccCCcCc---ceEECceehhhhhHhhhh
Confidence            3457889998665   459999999999998875


No 67 
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=26.10  E-value=36  Score=25.04  Aligned_cols=27  Identities=26%  Similarity=0.711  Sum_probs=21.3

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         1 C~VC~~~~~---g~hygv~sC~aCk~FFRR   27 (75)
T cd07155           1 CLVCGDIAS---GYHYGVASCEACKAFFKR   27 (75)
T ss_pred             CcccCccCc---ceEEChhhhhhhHHHHHH
Confidence            556776655   459999999999998865


No 68 
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=25.82  E-value=45  Score=26.20  Aligned_cols=34  Identities=26%  Similarity=0.607  Sum_probs=23.8

Q ss_pred             hcCCCCCCCcCCCCCC--------CCe---------eEcccceeeehhchh
Q 041407            6 LKLPENRECADCGSKA--------PRW---------ASVNLGIFICMQCSG   39 (241)
Q Consensus         6 ~~~pgN~~CaDCgs~~--------P~w---------as~n~GifvC~~Csg   39 (241)
                      .+.++--.|++||.+-        .++         ++=.||-.+|..|..
T Consensus        29 kK~~~~p~C~~cg~pL~Gi~r~RP~e~~r~skt~krp~RpYGG~lc~~c~~   79 (93)
T COG2174          29 KKKPTIPKCAICGRPLGGIPRGRPREFRRLSKTKKRPERPYGGYLCANCVR   79 (93)
T ss_pred             eccCCCCcccccCCccCCccCCCcHHHHhccccccCcCCCcCceecHHHHH
Confidence            4667778999999751        111         234689999999964


No 69 
>PRK11019 hypothetical protein; Provisional
Probab=25.44  E-value=18  Score=28.09  Aligned_cols=37  Identities=24%  Similarity=0.569  Sum_probs=25.5

Q ss_pred             CCCCCcCCCCCCC--CeeEcccceeeehhchhhhhcCCCc
Q 041407           10 ENRECADCGSKAP--RWASVNLGIFICMQCSGIHRSLGVH   47 (241)
Q Consensus        10 gN~~CaDCgs~~P--~was~n~GifvC~~CsgiHR~LG~h   47 (241)
                      .-..|.|||.+=|  ++.- --++..|+.|...+-..+.+
T Consensus        35 syg~C~~CG~~Ip~~Rl~A-~P~a~~Cv~Cq~~~E~~~k~   73 (88)
T PRK11019         35 SLTECEECGEPIPEARRKA-IPGVRLCVACQQEKDLQQAA   73 (88)
T ss_pred             cCCeeCcCCCcCcHHHHhh-cCCccccHHHHHHHHHHHhH
Confidence            4579999999744  2322 23778999999987655443


No 70 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=25.31  E-value=48  Score=23.64  Aligned_cols=28  Identities=29%  Similarity=0.787  Sum_probs=21.2

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhchhhhh
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQCSGIHR   42 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~CsgiHR   42 (241)
                      +.|.=||.+..   ...||+..|..|...=|
T Consensus         1 ~~C~VCg~~~~---~~~ygv~sC~~C~~FFr   28 (70)
T PF00105_consen    1 KKCKVCGDPAS---GYHYGVLSCNACKMFFR   28 (70)
T ss_dssp             -BSTTTSSBES---EEETTEEEEHHHHHHHH
T ss_pred             CCCeECCCccC---cccccccccccceeeee
Confidence            36888887554   56999999999998443


No 71 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=25.16  E-value=29  Score=27.65  Aligned_cols=33  Identities=18%  Similarity=0.289  Sum_probs=23.3

Q ss_pred             hcCCCCCCCcCCCCCCCCeeEcccceeeehhchhhh
Q 041407            6 LKLPENRECADCGSKAPRWASVNLGIFICMQCSGIH   41 (241)
Q Consensus         6 ~~~pgN~~CaDCgs~~P~was~n~GifvC~~CsgiH   41 (241)
                      ...|..-.|.+||..   +....+..+.|..|.+..
T Consensus        65 ~~~p~~~~C~~Cg~~---~~~~~~~~~~CP~Cgs~~   97 (114)
T PRK03681         65 EEQEAECWCETCQQY---VTLLTQRVRRCPQCHGDM   97 (114)
T ss_pred             EeeCcEEEcccCCCe---eecCCccCCcCcCcCCCC
Confidence            356788899999953   333345557899998754


No 72 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=24.79  E-value=32  Score=26.10  Aligned_cols=28  Identities=25%  Similarity=0.730  Sum_probs=23.0

Q ss_pred             CCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           13 ECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      .|.=||.+..   ...||+..|..|.+..|.
T Consensus         2 ~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   29 (86)
T cd07157           2 TCQVCGEPAA---GFHHGAYVCEACKKFFMR   29 (86)
T ss_pred             CCcccCCcCc---ccEECcceeeEeeeEEec
Confidence            4888887665   459999999999998875


No 73 
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=24.73  E-value=48  Score=23.11  Aligned_cols=33  Identities=27%  Similarity=0.740  Sum_probs=26.0

Q ss_pred             CCcCCCCC-CCCeeEcc-cceeeehhchhhhhcCC
Q 041407           13 ECADCGSK-APRWASVN-LGIFICMQCSGIHRSLG   45 (241)
Q Consensus        13 ~CaDCgs~-~P~was~n-~GifvC~~CsgiHR~LG   45 (241)
                      .|..|+.. -|.|=.-. -+..+|-.|..-.+..|
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~   35 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHG   35 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcC
Confidence            59999975 57787665 78899999977666665


No 74 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=24.69  E-value=36  Score=20.50  Aligned_cols=28  Identities=14%  Similarity=0.472  Sum_probs=17.6

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhchh
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQCSG   39 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~Csg   39 (241)
                      +.|.-|+..-+.-..-....++|..|..
T Consensus         2 ~~C~rC~~~~~~~~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    2 EKCPRCWNYIEDIGINGRSTYLCPRCQK   29 (30)
T ss_dssp             SB-TTT--BBEEEEETTEEEEE-TTTCC
T ss_pred             CcCccCCCcceEeEecCCCCeECcCCcC
Confidence            4678888876666666778899999864


No 75 
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=24.26  E-value=41  Score=24.56  Aligned_cols=27  Identities=30%  Similarity=0.826  Sum_probs=21.2

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         1 C~VCg~~~~---g~hygv~sC~aC~~FFRR   27 (73)
T cd06958           1 CVVCGDKSS---GKHYGQFTCEGCKSFFKR   27 (73)
T ss_pred             CCccCccCc---ceEEChhhhhhhhhhhhh
Confidence            555776655   358999999999998875


No 76 
>KOG1416 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD10 [Translation, ribosomal structure and biogenesis]
Probab=23.37  E-value=66  Score=32.02  Aligned_cols=43  Identities=16%  Similarity=0.135  Sum_probs=27.0

Q ss_pred             CChHHHHHHHhhCcHHHHHHHHhcCCCCCChHHHHHHHHHHHhc
Q 041407           59 WLPEQVAFMQSMGNEKSNKFWEAELPPNFDRSRIEKFIRTKYEE  102 (241)
Q Consensus        59 Ws~~el~~mk~~GN~~aN~~wEa~lP~~~d~~~re~fIraKYv~  102 (241)
                      .+.|||+.|+..|+. +.++-++-.-.+..-.+|-.|-+.||+.
T Consensus       115 Lt~EeI~~mr~eg~~-g~EiI~kLienSkTF~~KT~fSQeKYv~  157 (475)
T KOG1416|consen  115 LTQEEIEEMRQEGLS-GEEIIEKLIENSKTFHNKTVFSQEKYVL  157 (475)
T ss_pred             CCHHHHHHHHHhccC-HHHHHHHHHhcCcccccchhhhHHHHHH
Confidence            678999999998887 4555555332222223456666667754


No 77 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=23.34  E-value=40  Score=20.69  Aligned_cols=25  Identities=32%  Similarity=0.786  Sum_probs=12.9

Q ss_pred             CCCCCcCCCCC----CCCeeEcccceeeehhchhh
Q 041407           10 ENRECADCGSK----APRWASVNLGIFICMQCSGI   40 (241)
Q Consensus        10 gN~~CaDCgs~----~P~was~n~GifvC~~Csgi   40 (241)
                      .++.|.-||++    .-.|+      .+|..|...
T Consensus         2 ~~rfC~~CG~~t~~~~~g~~------r~C~~Cg~~   30 (32)
T PF09297_consen    2 NHRFCGRCGAPTKPAPGGWA------RRCPSCGHE   30 (32)
T ss_dssp             TTSB-TTT--BEEE-SSSS-------EEESSSS-E
T ss_pred             CCcccCcCCccccCCCCcCE------eECCCCcCE
Confidence            37899999986    22343      577777543


No 78 
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=23.30  E-value=52  Score=24.01  Aligned_cols=27  Identities=37%  Similarity=0.950  Sum_probs=21.7

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         2 C~vCg~~~~---~~hygv~sC~aC~~FFRR   28 (73)
T cd06959           2 CVVCGDKAS---GFHYGVLSCEGCKGFFRR   28 (73)
T ss_pred             CceeCCcCc---ceEECceeehhhHHHHHH
Confidence            666777655   459999999999998875


No 79 
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=22.34  E-value=38  Score=25.62  Aligned_cols=28  Identities=32%  Similarity=0.746  Sum_probs=23.1

Q ss_pred             CCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           13 ECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      .|.=||.+...   ..||+..|..|.+..|.
T Consensus         3 ~C~VCg~~a~g---~hyGv~sC~aCk~FFRR   30 (84)
T cd06962           3 LCVVCGDKASG---YHYNALTCEGCKGFFRR   30 (84)
T ss_pred             CCeecCCcCcc---eEECcceeecceeeeee
Confidence            48888876664   59999999999998874


No 80 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=22.31  E-value=43  Score=24.56  Aligned_cols=27  Identities=37%  Similarity=0.944  Sum_probs=21.1

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         1 C~vCg~~~~---~~hygv~~C~aC~~FFrR   27 (76)
T cd06960           1 CAVCGDRAT---GKHYGVLSCNGCKGFFRR   27 (76)
T ss_pred             CCccCccCc---ccEECcceeeeehheeCc
Confidence            556777654   458999999999998875


No 81 
>COG2158 Uncharacterized protein containing a Zn-finger-like domain [General function prediction only]
Probab=21.73  E-value=55  Score=26.45  Aligned_cols=31  Identities=32%  Similarity=0.729  Sum_probs=24.5

Q ss_pred             CcCCCCCCCCeeEcccc--eeeehhchhhhhcCCC
Q 041407           14 CADCGSKAPRWASVNLG--IFICMQCSGIHRSLGV   46 (241)
Q Consensus        14 CaDCgs~~P~was~n~G--ifvC~~CsgiHR~LG~   46 (241)
                      |.||+. + .|++-.-|  |.-|.+|-=|||.-++
T Consensus        45 c~~~~~-g-ewi~~~~G~~VwSC~dC~~iH~ke~~   77 (112)
T COG2158          45 CENEEL-G-EWISDSNGRKVWSCSDCHWIHRKEGA   77 (112)
T ss_pred             cccccc-C-ceeEcCCCCEEeeccccceecccchH
Confidence            445544 3 89999999  9999999999987553


No 82 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.54  E-value=41  Score=29.72  Aligned_cols=22  Identities=27%  Similarity=0.825  Sum_probs=19.0

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhchhh
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQCSGI   40 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~Csgi   40 (241)
                      +.|.-||.       +.-+.|.|..|...
T Consensus       310 ~~C~~cg~-------~~~r~~~C~~cg~~  331 (364)
T COG0675         310 KTCPCCGH-------LSGRLFKCPRCGFV  331 (364)
T ss_pred             ccccccCC-------ccceeEECCCCCCe
Confidence            78999999       67899999999763


No 83 
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain. RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain. This protein has a domain architecture of SH2-SH3-SH2-PH-C2-Ras_GAP. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=21.43  E-value=43  Score=26.13  Aligned_cols=61  Identities=15%  Similarity=0.089  Sum_probs=33.7

Q ss_pred             CCcccccchhHHHhhhhhhccCCCCCCCCCCCCCccccccCCCCCCCCCCCCceeEeeccCCC
Q 041407          136 PRKTRTLSLEEEILTKHIAQIAPPPTVGRSRGGSLDMNEKAAAPIPPRVPPSVAEVQVPTNNK  198 (241)
Q Consensus       136 ~~k~r~l~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  198 (241)
                      .+|.|+..|....-..++....++  ....+-|.||+....-.|....+-++++||.+.++..
T Consensus        15 ~wK~rwF~l~~~~s~~~l~yf~~~--~~~~p~gli~l~~~~V~~v~ds~~~r~~cFel~~~~~   75 (98)
T cd01245          15 LWKTLYFALILDGSRSHESLLSSP--KKTKPIGLIDLSDAYLYPVHDSLFGRPNCFQIVERAL   75 (98)
T ss_pred             ccceeEEEEecCCCCceEEEEcCC--CCCCccceeeccccEEEEccccccCCCeEEEEecCCC
Confidence            455777777421112344455544  3345557888888832222222235679999976544


No 84 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=21.39  E-value=51  Score=23.71  Aligned_cols=27  Identities=30%  Similarity=0.877  Sum_probs=21.7

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.-||.+...+   .||+..|..|.+..|.
T Consensus         2 C~vC~~~~~~~---hygv~~C~aC~~FFRR   28 (70)
T smart00399        2 CCVCGDHASGF---HFGVCSCRACKAFFRR   28 (70)
T ss_pred             CeEeCCcCccc---EeCCcEechhhhhhhh
Confidence            66787766544   8999999999998875


No 85 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=21.26  E-value=44  Score=22.46  Aligned_cols=27  Identities=26%  Similarity=0.645  Sum_probs=18.7

Q ss_pred             CCcCCCCCCCCeeEcccceeeehhchhhhhcC
Q 041407           13 ECADCGSKAPRWASVNLGIFICMQCSGIHRSL   44 (241)
Q Consensus        13 ~CaDCgs~~P~was~n~GifvC~~CsgiHR~L   44 (241)
                      .|.+||....-.   ..+..-|..|.  ||-|
T Consensus         4 ~C~~Cg~~~~~~---~~~~irC~~CG--~rIl   30 (44)
T smart00659        4 ICGECGRENEIK---SKDVVRCRECG--YRIL   30 (44)
T ss_pred             ECCCCCCEeecC---CCCceECCCCC--ceEE
Confidence            699999864322   56788999994  4443


No 86 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=21.06  E-value=72  Score=24.40  Aligned_cols=28  Identities=25%  Similarity=0.723  Sum_probs=22.0

Q ss_pred             CCCCcCCCCCCCCeeEccc--------ceeeehhch
Q 041407           11 NRECADCGSKAPRWASVNL--------GIFICMQCS   38 (241)
Q Consensus        11 N~~CaDCgs~~P~was~n~--------GifvC~~Cs   38 (241)
                      +..|..||.....|..+-.        -.|+|..|.
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q~RsadE~~T~fy~C~~C~   97 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQTRRADEPETRFYKCTKCG   97 (104)
T ss_pred             cCCCCCCCCCeeEEEEeccCCCCCCcEEEEEeCCCC
Confidence            6899999999888875533        378898885


No 87 
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=20.98  E-value=42  Score=25.51  Aligned_cols=29  Identities=31%  Similarity=0.728  Sum_probs=23.7

Q ss_pred             CCCcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           12 RECADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        12 ~~CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      ..|.=||.....   ..||+..|..|.+..|.
T Consensus         4 ~~C~VCg~~~~g---~hyGv~sC~aC~~FFRR   32 (87)
T cd06967           4 ELCVVCGDKASG---RHYGAVSCEGCKGFFKR   32 (87)
T ss_pred             CCCeecCCcCCc---CEeCcceEeeeeeEeee
Confidence            458889987664   48999999999998864


No 88 
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=20.97  E-value=48  Score=25.09  Aligned_cols=27  Identities=33%  Similarity=0.771  Sum_probs=21.8

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.....   ..||+..|..|.+..|.
T Consensus         2 C~VCg~~~~g---~hygv~sC~aC~~FFRR   28 (85)
T cd06961           2 CVVCGDKATG---YHYRCITCEGCKGFFRR   28 (85)
T ss_pred             CceeCCcCcc---eEEChhhhhhhhHhhHh
Confidence            6678876554   48999999999998875


No 89 
>PHA00080 DksA-like zinc finger domain containing protein
Probab=20.65  E-value=30  Score=25.60  Aligned_cols=35  Identities=29%  Similarity=0.681  Sum_probs=23.0

Q ss_pred             CCCCCCCcCCCCCCC--CeeEcccceeeehhchhhhhc
Q 041407            8 LPENRECADCGSKAP--RWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus         8 ~pgN~~CaDCgs~~P--~was~n~GifvC~~CsgiHR~   43 (241)
                      .++...|.+||.+=|  ++.- .-|+..|+.|...+-.
T Consensus        28 ~~~~~~C~~Cg~~Ip~~Rl~a-~P~~~~Cv~Cq~~~E~   64 (72)
T PHA00080         28 APSATHCEECGDPIPEARREA-VPGCRTCVSCQEILEL   64 (72)
T ss_pred             CCCCCEecCCCCcCcHHHHHh-CCCccCcHHHHHHHHH
Confidence            345568999998633  2222 2366789999887543


No 90 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=20.29  E-value=57  Score=24.13  Aligned_cols=27  Identities=30%  Similarity=0.784  Sum_probs=21.1

Q ss_pred             CcCCCCCCCCeeEcccceeeehhchhhhhc
Q 041407           14 CADCGSKAPRWASVNLGIFICMQCSGIHRS   43 (241)
Q Consensus        14 CaDCgs~~P~was~n~GifvC~~CsgiHR~   43 (241)
                      |.=||.+...   ..||+..|..|.+..|.
T Consensus         1 C~VCg~~~~g---~hyG~~~C~~C~~FFRR   27 (78)
T cd07164           1 CRVCGDRASG---KHYGVPSCDGCRGFFKR   27 (78)
T ss_pred             CcccCccCcc---eEECcchhhhhhhhhhh
Confidence            5557766553   48999999999998875


No 91 
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain. Gab (Grb2-associated binder) pleckstrin homology (PH) domain. The Gab subfamily includes several Gab proteins, Drosophila DOS and C. elegans SOC-1. They are scaffolding adaptor proteins, which possess N-terminal PH domains and a C-terminus with proline-rich regions and multiple phosphorylation sites. Following activation of growth factor receptors, Gab proteins are tyrosine phosphorylated and activate PI3K, which generates 3-phosphoinositide lipids. By binding to these lipids via the PH domain, Gab proteins remain in proximity to the receptor, leading to further signaling. While not all Gab proteins depend on the PH domain for recruitment, it is required for Gab activity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display str
Probab=20.22  E-value=54  Score=25.23  Aligned_cols=43  Identities=7%  Similarity=-0.120  Sum_probs=27.8

Q ss_pred             CCCcccccchhHHHh--h-hhhhccCCCCCCCCCCCCCccccccCCCC
Q 041407          135 IPRKTRTLSLEEEIL--T-KHIAQIAPPPTVGRSRGGSLDMNEKAAAP  179 (241)
Q Consensus       135 ~~~k~r~l~~~~~~~--~-~~~~~~~p~~~~~~~~~~s~~~~~~~~~~  179 (241)
                      ..++.|+..|.+..+  . -.+.++.-+  ....+-|+|||+....++
T Consensus        17 ~~WkrRwFvL~~~~l~~~~~~L~Yyk~~--~~~k~~g~I~L~~~~~v~   62 (108)
T cd01266          17 TKWVRRYFVLHCGDRERNLFALEYYKTS--RKFKLEFVIDLESCSQVD   62 (108)
T ss_pred             cCcEEEEEEEeccccCCCcceEEEECCC--CCCccceEEECCccEEEc
Confidence            467899999976432  1 123344433  567888999999976553


Done!