Query         041414
Match_columns 152
No_of_seqs    219 out of 1557
Neff          10.0
Searched_HMMs 46136
Date          Fri Mar 29 06:47:57 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041414.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041414hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462 C2H2-type Zn-finger pr  99.9 7.5E-26 1.6E-30  157.8   4.2  124    2-129   134-270 (279)
  2 KOG2462 C2H2-type Zn-finger pr  99.8 3.1E-22 6.7E-27  139.8   1.1   92    2-97    165-265 (279)
  3 KOG1074 Transcriptional repres  99.7 4.1E-18 8.8E-23  133.7   1.0   48    3-52    358-405 (958)
  4 KOG3576 Ovo and related transc  99.5 1.5E-15 3.2E-20  102.3  -2.3   74   24-97    113-195 (267)
  5 KOG3623 Homeobox transcription  99.4 1.1E-14 2.3E-19  113.5   0.1   73   24-96    890-971 (1007)
  6 KOG1074 Transcriptional repres  99.4 1.6E-14 3.6E-19  113.8  -0.3   82    2-100   609-693 (958)
  7 KOG3623 Homeobox transcription  99.4 1.2E-13 2.6E-18  107.8   1.5   70   54-123   892-971 (1007)
  8 KOG3608 Zn finger proteins [Ge  99.4 2.7E-14 5.8E-19  103.3  -3.0  135    2-145   183-358 (467)
  9 KOG3576 Ovo and related transc  99.3 1.2E-13 2.5E-18   93.2  -0.3   75   52-126   113-197 (267)
 10 PHA00733 hypothetical protein   99.2 1.6E-11 3.6E-16   78.9   4.2   76    3-100    45-124 (128)
 11 KOG3608 Zn finger proteins [Ge  99.1 2.2E-11 4.8E-16   88.4   2.2   93    2-97    267-374 (467)
 12 PHA02768 hypothetical protein;  99.1 6.4E-11 1.4E-15   64.0   2.0   44   28-92      5-48  (55)
 13 PLN03086 PRLI-interacting fact  98.9 3.6E-09 7.8E-14   82.5   6.1   83   28-115   453-554 (567)
 14 PHA02768 hypothetical protein;  98.8 3.9E-09 8.5E-14   57.1   2.4   42   75-118     5-47  (55)
 15 PF13465 zf-H2C2_2:  Zinc-finge  98.8 7.4E-10 1.6E-14   51.4  -0.5   23   17-39      3-25  (26)
 16 PF13465 zf-H2C2_2:  Zinc-finge  98.7 9.1E-09   2E-13   47.7   2.3   26   43-87      1-26  (26)
 17 PHA00733 hypothetical protein   98.7   6E-09 1.3E-13   67.1   0.5   87   25-126    37-123 (128)
 18 PHA00732 hypothetical protein   98.6 3.3E-08 7.1E-13   58.2   2.7   47   28-99      1-48  (79)
 19 PHA00616 hypothetical protein   98.6 2.9E-08 6.4E-13   51.1   1.4   31   75-105     1-31  (44)
 20 PLN03086 PRLI-interacting fact  98.5 9.4E-08   2E-12   74.8   3.1   86    3-97    458-562 (567)
 21 PHA00616 hypothetical protein   98.5 5.9E-08 1.3E-12   50.0   1.3   32   28-59      1-32  (44)
 22 KOG3993 Transcription factor (  98.4 7.6E-08 1.7E-12   71.8   1.5   75   27-101   294-382 (500)
 23 PF00096 zf-C2H2:  Zinc finger,  98.3 3.1E-07 6.8E-12   41.1   1.7   23   76-98      1-23  (23)
 24 COG5189 SFP1 Putative transcri  98.2 6.4E-07 1.4E-11   64.8   2.6   72   24-96    345-419 (423)
 25 KOG3993 Transcription factor (  98.1 1.8E-06 3.9E-11   64.6   2.9   50    2-53    299-381 (500)
 26 PF00096 zf-C2H2:  Zinc finger,  98.1 1.7E-06 3.7E-11   38.6   1.6   23   29-51      1-23  (23)
 27 PF05605 zf-Di19:  Drought indu  98.1 6.4E-06 1.4E-10   45.0   4.2   51   28-99      2-53  (54)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.0   4E-06 8.6E-11   39.0   1.6   26   75-100     1-26  (27)
 29 PF13894 zf-C2H2_4:  C2H2-type   98.0 5.1E-06 1.1E-10   37.2   1.8   24   76-99      1-24  (24)
 30 PHA00732 hypothetical protein   97.9 8.3E-06 1.8E-10   48.0   2.2   38   75-114     1-39  (79)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.3E-05   5E-10   47.9   2.6   70   30-100     1-75  (100)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.8E-05 3.9E-10   36.7   1.3   25   28-52      1-25  (27)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.7 3.3E-05   7E-10   34.4   2.0   23   29-51      1-23  (24)
 34 PF09237 GAGA:  GAGA factor;  I  97.7 4.1E-05 8.8E-10   40.5   2.5   32   72-103    21-52  (54)
 35 smart00355 ZnF_C2H2 zinc finge  97.6 5.6E-05 1.2E-09   34.2   1.8   25   76-100     1-25  (26)
 36 PF09237 GAGA:  GAGA factor;  I  97.5 0.00013 2.7E-09   38.6   2.6   33   24-56     20-52  (54)
 37 smart00355 ZnF_C2H2 zinc finge  97.3 0.00025 5.5E-09   31.9   2.1   24   29-52      1-24  (26)
 38 PF12874 zf-met:  Zinc-finger o  97.1 0.00034 7.3E-09   31.6   1.4   23   76-98      1-23  (25)
 39 PRK04860 hypothetical protein;  96.8 0.00084 1.8E-08   44.9   2.2   39   27-88    118-156 (160)
 40 PF13909 zf-H2C2_5:  C2H2-type   96.8 0.00091   2E-08   29.9   1.6   23   76-99      1-23  (24)
 41 COG5048 FOG: Zn-finger [Genera  96.8 0.00094   2E-08   50.8   2.5   56    2-59    293-354 (467)
 42 PF12874 zf-met:  Zinc-finger o  96.7 0.00086 1.9E-08   30.2   1.1   23   29-51      1-23  (25)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5 0.00081 1.8E-08   31.0   0.5   22   76-97      2-23  (27)
 44 KOG1146 Homeobox protein [Gene  96.4  0.0032 6.8E-08   53.9   3.1   93    2-97    440-540 (1406)
 45 PF13913 zf-C2HC_2:  zinc-finge  95.9   0.006 1.3E-07   27.6   1.6   21   76-97      3-23  (25)
 46 PF13909 zf-H2C2_5:  C2H2-type   95.8  0.0068 1.5E-07   26.9   1.5   23   29-52      1-23  (24)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  95.6  0.0036 7.8E-08   28.8   0.2   22   29-50      2-23  (27)
 48 PF12756 zf-C2H2_2:  C2H2 type   95.4   0.013 2.8E-07   35.5   2.3   24   28-51     50-73  (100)
 49 KOG2893 Zn finger protein [Gen  95.1  0.0078 1.7E-07   42.4   0.5   48   29-99     11-59  (341)
 50 PRK04860 hypothetical protein;  95.0   0.019 4.2E-07   38.4   2.2   38   74-115   118-156 (160)
 51 smart00451 ZnF_U1 U1-like zinc  94.9   0.021 4.6E-07   27.7   1.7   23   75-97      3-25  (35)
 52 COG5189 SFP1 Putative transcri  94.7   0.031 6.7E-07   41.1   2.9   26   72-97    346-373 (423)
 53 smart00451 ZnF_U1 U1-like zinc  94.6   0.031 6.7E-07   27.1   1.9   23   28-50      3-25  (35)
 54 PF05605 zf-Di19:  Drought indu  93.1    0.11 2.3E-06   28.1   2.5   35   75-110     2-39  (54)
 55 COG5048 FOG: Zn-finger [Genera  93.0   0.055 1.2E-06   41.1   1.6   61   28-105   289-353 (467)
 56 COG4049 Uncharacterized protei  90.8    0.13 2.8E-06   27.8   1.0   28   70-97     12-39  (65)
 57 KOG2186 Cell growth-regulating  88.5    0.39 8.5E-06   34.4   2.3   47   28-96      3-49  (276)
 58 cd00350 rubredoxin_like Rubred  86.8    0.47   1E-05   22.8   1.4   10   74-83     16-25  (33)
 59 smart00614 ZnF_BED BED zinc fi  86.8    0.61 1.3E-05   24.7   1.9   24   76-99     19-48  (50)
 60 PF09986 DUF2225:  Uncharacteri  86.7    0.22 4.7E-06   35.1   0.2   20   26-45      3-22  (214)
 61 PF05443 ROS_MUCR:  ROS/MUCR tr  85.7    0.48   1E-05   30.7   1.4   30   73-105    70-99  (132)
 62 KOG4167 Predicted DNA-binding   85.4    0.22 4.7E-06   40.8  -0.4   28   74-101   791-818 (907)
 63 KOG1146 Homeobox protein [Gene  84.1    0.53 1.2E-05   41.1   1.3   70   26-98   1282-1351(1406)
 64 COG4049 Uncharacterized protei  83.7    0.59 1.3E-05   25.3   0.9   32   21-52     10-41  (65)
 65 PF02892 zf-BED:  BED zinc fing  83.6     1.1 2.4E-05   22.9   2.0   24   73-96     14-41  (45)
 66 smart00734 ZnF_Rad18 Rad18-lik  83.1    0.94   2E-05   20.5   1.4   20   76-96      2-21  (26)
 67 PF09538 FYDLN_acid:  Protein o  81.1     0.9   2E-05   28.4   1.2   15   74-88     25-39  (108)
 68 cd00729 rubredoxin_SM Rubredox  78.6     1.5 3.2E-05   21.2   1.3   10   74-83     17-26  (34)
 69 COG2888 Predicted Zn-ribbon RN  77.7     2.3 4.9E-05   23.4   1.9   11   73-83     48-58  (61)
 70 PRK00398 rpoP DNA-directed RNA  76.3     1.5 3.2E-05   22.7   1.0   12   75-86     21-32  (46)
 71 TIGR02098 MJ0042_CXXC MJ0042 f  76.2     1.1 2.4E-05   22.0   0.5   14   29-42      3-16  (38)
 72 TIGR00622 ssl1 transcription f  74.9     9.2  0.0002   24.0   4.3   74   26-99     13-105 (112)
 73 COG1997 RPL43A Ribosomal prote  74.4     2.8 6.2E-05   25.0   1.9   31   56-88     35-66  (89)
 74 KOG2893 Zn finger protein [Gen  74.0    0.76 1.7E-05   32.7  -0.7   42   11-52     17-59  (341)
 75 PF13719 zinc_ribbon_5:  zinc-r  73.1       3 6.6E-05   20.5   1.6   14   73-86     23-36  (37)
 76 smart00531 TFIIE Transcription  72.6     2.6 5.7E-05   27.7   1.7   18   25-42     96-113 (147)
 77 COG4957 Predicted transcriptio  70.7     2.3   5E-05   27.5   1.0   27   75-104    76-102 (148)
 78 TIGR00373 conserved hypothetic  70.7     3.1 6.6E-05   27.8   1.7   21   24-44    105-125 (158)
 79 KOG4124 Putative transcription  69.9     1.4   3E-05   33.2  -0.1   69   26-95    347-418 (442)
 80 PRK14890 putative Zn-ribbon RN  69.8       4 8.7E-05   22.5   1.7   11   73-83     46-56  (59)
 81 PRK06266 transcription initiat  68.9     3.2 6.9E-05   28.4   1.5   20   25-44    114-133 (178)
 82 PF12013 DUF3505:  Protein of u  68.4     4.1 8.9E-05   25.2   1.8   70   27-100    10-109 (109)
 83 TIGR02300 FYDLN_acid conserved  68.0     3.4 7.4E-05   26.5   1.4   20   73-92     24-43  (129)
 84 smart00659 RPOLCX RNA polymera  67.5     3.9 8.5E-05   21.1   1.3   13   28-40      2-14  (44)
 85 PF04959 ARS2:  Arsenite-resist  67.0     4.3 9.3E-05   28.6   1.8   29   24-52     73-101 (214)
 86 KOG4167 Predicted DNA-binding   65.9     1.2 2.6E-05   36.7  -1.2   26   28-53    792-817 (907)
 87 PF01927 Mut7-C:  Mut7-C RNAse   65.5       5 0.00011   26.4   1.8   22   73-94    122-143 (147)
 88 PRK00464 nrdR transcriptional   65.1     4.8  0.0001   26.9   1.7   18   74-91     27-44  (154)
 89 KOG2186 Cell growth-regulating  63.9     4.3 9.2E-05   29.3   1.3   40   75-115     3-42  (276)
 90 PHA00626 hypothetical protein   63.7     6.9 0.00015   21.3   1.8   15   74-88     22-36  (59)
 91 PF07754 DUF1610:  Domain of un  63.5     3.3 7.2E-05   18.4   0.5   10   74-83     15-24  (24)
 92 PF04810 zf-Sec23_Sec24:  Sec23  62.4       6 0.00013   19.8   1.4   18   67-84     16-33  (40)
 93 smart00834 CxxC_CXXC_SSSS Puta  62.3     3.6 7.8E-05   20.3   0.6   30   75-110     5-34  (41)
 94 KOG2231 Predicted E3 ubiquitin  62.3     9.3  0.0002   31.6   3.1   25   77-101   184-208 (669)
 95 PF05290 Baculo_IE-1:  Baculovi  61.0     3.7   8E-05   26.6   0.6   20   22-41     74-93  (140)
 96 PF09723 Zn-ribbon_8:  Zinc rib  59.9     4.2   9E-05   20.6   0.6   30   75-110     5-34  (42)
 97 COG1592 Rubrerythrin [Energy p  59.6     5.4 0.00012   26.9   1.2   23   56-82    134-156 (166)
 98 PRK09678 DNA-binding transcrip  59.4       6 0.00013   22.8   1.2   19   73-91     25-45  (72)
 99 PF06524 NOA36:  NOA36 protein;  59.3     5.7 0.00012   28.8   1.3   76   23-99    137-233 (314)
100 KOG2785 C2H2-type Zn-finger pr  58.5     5.4 0.00012   30.5   1.1   70   28-97      3-90  (390)
101 PF10571 UPF0547:  Uncharacteri  58.4     4.5 9.8E-05   18.3   0.5   11   76-86     15-25  (26)
102 KOG2785 C2H2-type Zn-finger pr  56.7      14 0.00031   28.3   3.1   68   27-97    165-242 (390)
103 PTZ00255 60S ribosomal protein  56.5     4.7  0.0001   24.3   0.5   15   74-88     53-67  (90)
104 PF04959 ARS2:  Arsenite-resist  56.1     4.4 9.6E-05   28.6   0.4   25   73-97     75-99  (214)
105 PF15269 zf-C2H2_7:  Zinc-finge  56.1     8.3 0.00018   19.9   1.3   22   76-97     21-42  (54)
106 KOG4173 Alpha-SNAP protein [In  55.5     3.6 7.8E-05   28.7  -0.2   84    2-100    85-172 (253)
107 cd00924 Cyt_c_Oxidase_Vb Cytoc  53.7     6.7 0.00015   24.0   0.8   19   21-40     73-91  (97)
108 smart00154 ZnF_AN1 AN1-like Zi  52.6       7 0.00015   19.5   0.7   14   75-88     12-25  (39)
109 PF01780 Ribosomal_L37ae:  Ribo  52.0     3.9 8.5E-05   24.6  -0.4   13   75-87     53-65  (90)
110 PF12013 DUF3505:  Protein of u  51.2      14 0.00031   22.8   2.1   25   29-53     81-109 (109)
111 PLN02294 cytochrome c oxidase   50.9     8.2 0.00018   26.1   1.0   20   68-88    135-154 (174)
112 COG4530 Uncharacterized protei  50.3     7.5 0.00016   24.3   0.7   15   73-87     24-38  (129)
113 TIGR02605 CxxC_CxxC_SSSS putat  50.1     7.4 0.00016   20.4   0.6   30   75-110     5-34  (52)
114 COG5236 Uncharacterized conser  49.4      47   0.001   25.4   4.7   69   30-99    222-305 (493)
115 KOG3408 U1-like Zn-finger-cont  49.4      11 0.00024   24.0   1.3   25   73-97     55-79  (129)
116 TIGR00280 L37a ribosomal prote  48.7     6.4 0.00014   23.7   0.2   14   75-88     53-66  (91)
117 COG3357 Predicted transcriptio  48.6     9.2  0.0002   23.0   0.8   14   27-40     57-70  (97)
118 KOG0717 Molecular chaperone (D  48.4      11 0.00024   29.7   1.4   21   76-96    293-313 (508)
119 PF01428 zf-AN1:  AN1-like Zinc  47.8     7.2 0.00016   19.8   0.3   15   74-88     12-26  (43)
120 PF09845 DUF2072:  Zn-ribbon co  47.6     8.5 0.00018   24.9   0.6   15   75-89      1-15  (131)
121 PF13451 zf-trcl:  Probable zin  47.5     9.4  0.0002   20.2   0.7   18   73-90      2-19  (49)
122 PF13717 zinc_ribbon_4:  zinc-r  46.7      13 0.00029   18.1   1.1   11   28-38     25-35  (36)
123 PF10276 zf-CHCC:  Zinc-finger   46.3      10 0.00023   19.1   0.7   12   27-38     28-39  (40)
124 PF04423 Rad50_zn_hook:  Rad50   45.4     8.2 0.00018   20.6   0.3   12   77-88     22-33  (54)
125 COG3677 Transposase and inacti  44.5      16 0.00034   23.6   1.5   16   73-88     51-66  (129)
126 PF13878 zf-C2H2_3:  zinc-finge  44.3     2.9 6.3E-05   21.1  -1.5   21    3-23     18-38  (41)
127 COG1198 PriA Primosomal protei  42.3     8.9 0.00019   32.2   0.2   48   30-84    437-484 (730)
128 PRK03976 rpl37ae 50S ribosomal  42.2     8.7 0.00019   23.1   0.1   14   75-88     54-67  (90)
129 KOG2071 mRNA cleavage and poly  41.9      18 0.00039   29.4   1.8   28   25-52    415-442 (579)
130 PRK12380 hydrogenase nickel in  41.2      15 0.00032   23.1   1.0   15   26-40     68-82  (113)
131 PF08790 zf-LYAR:  LYAR-type C2  40.8       9  0.0002   17.7  -0.0   19   76-95      1-19  (28)
132 PF01096 TFIIS_C:  Transcriptio  39.8      24 0.00052   17.5   1.5   11   75-85     28-38  (39)
133 KOG3408 U1-like Zn-finger-cont  39.6      20 0.00043   22.9   1.4   24   27-50     56-79  (129)
134 KOG2071 mRNA cleavage and poly  39.4      19 0.00042   29.2   1.6   29   73-101   416-444 (579)
135 PF01363 FYVE:  FYVE zinc finge  38.9      16 0.00035   20.3   0.8   12   28-39      9-20  (69)
136 TIGR00100 hypA hydrogenase nic  38.8      18 0.00038   22.8   1.1   19   22-40     64-82  (115)
137 PRK14873 primosome assembly pr  38.4      26 0.00057   29.2   2.2   47   30-84    385-431 (665)
138 KOG2807 RNA polymerase II tran  38.2      70  0.0015   24.3   4.1   69   27-99    289-369 (378)
139 KOG2482 Predicted C2H2-type Zn  38.0      30 0.00064   26.4   2.2   29   75-103   195-225 (423)
140 PF04780 DUF629:  Protein of un  37.8      23  0.0005   28.1   1.8   28   75-102    57-85  (466)
141 PF07282 OrfB_Zn_ribbon:  Putat  37.7      27 0.00059   19.4   1.7   15   73-87     44-58  (69)
142 PRK00564 hypA hydrogenase nick  36.7      21 0.00045   22.6   1.2   19   22-40     65-83  (117)
143 COG3364 Zn-ribbon containing p  35.9      20 0.00042   22.2   0.9   16   75-90      2-17  (112)
144 PF10013 DUF2256:  Uncharacteri  35.6      16 0.00034   18.7   0.4   15   76-90      9-23  (42)
145 KOG2636 Splicing factor 3a, su  35.4      26 0.00056   27.6   1.7   29   68-96    394-423 (497)
146 PF15135 UPF0515:  Uncharacteri  35.4      45 0.00097   24.2   2.7   59   22-88    106-168 (278)
147 COG1773 Rubredoxin [Energy pro  35.2      18 0.00038   19.7   0.6   15   74-88      2-16  (55)
148 PF12760 Zn_Tnp_IS1595:  Transp  34.2      41 0.00089   17.2   1.9   11   73-83     35-45  (46)
149 KOG1842 FYVE finger-containing  33.5      22 0.00048   28.0   1.0   28   74-101    14-42  (505)
150 PRK03681 hypA hydrogenase nick  33.5      24 0.00051   22.2   1.0   16   24-39     66-81  (114)
151 cd00065 FYVE FYVE domain; Zinc  33.2      29 0.00062   18.3   1.2   11   30-40      4-14  (57)
152 KOG2593 Transcription initiati  33.1      30 0.00065   27.1   1.7   21   23-43    123-143 (436)
153 PF01215 COX5B:  Cytochrome c o  32.9      20 0.00043   23.4   0.6   20   68-88    106-125 (136)
154 TIGR00595 priA primosomal prot  32.7      13 0.00029   29.7  -0.2   47   30-83    215-261 (505)
155 smart00440 ZnF_C2C2 C2C2 Zinc   32.4      50  0.0011   16.4   1.9   12   75-86     28-39  (40)
156 PHA02998 RNA polymerase subuni  31.4      39 0.00085   23.2   1.8   12   76-87    172-183 (195)
157 PF08271 TF_Zn_Ribbon:  TFIIB z  31.0      32  0.0007   17.2   1.1   11   75-85     19-29  (43)
158 PTZ00448 hypothetical protein;  31.0      32 0.00068   26.4   1.5   25   75-99    314-338 (373)
159 KOG2482 Predicted C2H2-type Zn  30.8      32  0.0007   26.2   1.5   23   28-50    195-217 (423)
160 PF11931 DUF3449:  Domain of un  30.1      17 0.00037   25.3   0.0   29   68-96     94-123 (196)
161 TIGR01206 lysW lysine biosynth  30.1      22 0.00047   19.2   0.4   31   75-112     2-32  (54)
162 PF14353 CpXC:  CpXC protein     29.2      25 0.00053   22.4   0.6   22   74-95     37-58  (128)
163 PTZ00043 cytochrome c oxidase   29.0      27 0.00059   24.9   0.8   15   73-87    179-193 (268)
164 PF07295 DUF1451:  Protein of u  28.9      28 0.00062   23.0   0.9    6   77-82    132-137 (146)
165 COG1571 Predicted DNA-binding   28.7      32 0.00069   26.9   1.2   16   74-89    366-381 (421)
166 TIGR00416 sms DNA repair prote  26.7      45 0.00098   26.4   1.8   11   74-84     20-30  (454)
167 PF08209 Sgf11:  Sgf11 (transcr  26.5      74  0.0016   15.2   1.9   24   75-99      4-27  (33)
168 PF11238 DUF3039:  Protein of u  26.1      31 0.00068   18.9   0.6   26    2-38     29-54  (58)
169 PF07975 C1_4:  TFIIH C1-like d  26.0      18 0.00039   19.3  -0.4   26   74-99     20-45  (51)
170 PRK11823 DNA repair protein Ra  26.0      48   0.001   26.2   1.8   12   27-38      6-17  (446)
171 smart00064 FYVE Protein presen  25.7      45 0.00097   18.4   1.2   11   29-39     11-21  (68)
172 PF03604 DNA_RNApol_7kD:  DNA d  25.7      32  0.0007   16.3   0.5   11   76-86      1-11  (32)
173 PF06397 Desulfoferrod_N:  Desu  25.3      33 0.00072   16.8   0.5   12   27-38      5-16  (36)
174 KOG1813 Predicted E3 ubiquitin  25.1      44 0.00095   24.9   1.3   59   26-97    239-301 (313)
175 PF09416 UPF1_Zn_bind:  RNA hel  25.1      30 0.00064   23.1   0.4   20    3-22     19-38  (152)
176 COG1996 RPC10 DNA-directed RNA  24.8      31 0.00066   18.3   0.4   13   73-85      4-16  (49)
177 KOG0717 Molecular chaperone (D  24.8      48   0.001   26.4   1.5   21   29-49    293-313 (508)
178 COG5188 PRP9 Splicing factor 3  24.6      46   0.001   25.5   1.4   29   68-96    367-396 (470)
179 PF01286 XPA_N:  XPA protein N-  24.5      32 0.00069   16.7   0.4   13   77-89      5-17  (34)
180 COG0068 HypF Hydrogenase matur  23.9      19  0.0004   30.1  -0.8   51   30-83    125-181 (750)
181 KOG2231 Predicted E3 ubiquitin  23.6      74  0.0016   26.6   2.4   72   30-105   184-273 (669)
182 smart00661 RPOL9 RNA polymeras  23.4      86  0.0019   16.1   2.0   12   75-86     20-31  (52)
183 PF05191 ADK_lid:  Adenylate ki  22.9      36 0.00079   16.6   0.4   12   76-87      2-13  (36)
184 COG5112 UFD2 U1-like Zn-finger  22.3      43 0.00093   20.8   0.7   24   73-96     53-76  (126)
185 TIGR00686 phnA alkylphosphonat  22.2      48   0.001   20.7   0.9   15   74-88     18-32  (109)
186 PRK03824 hypA hydrogenase nick  21.9      56  0.0012   21.2   1.3   20   22-41     64-83  (135)
187 PF00301 Rubredoxin:  Rubredoxi  21.8      43 0.00092   17.5   0.6   13   76-88      2-14  (47)
188 PF14787 zf-CCHC_5:  GAG-polypr  21.7      38 0.00083   16.6   0.3   14   77-90      4-17  (36)
189 PF08792 A2L_zn_ribbon:  A2L zi  21.4      47   0.001   15.8   0.6   12   75-86     21-32  (33)
190 cd00730 rubredoxin Rubredoxin;  21.3      38 0.00083   17.9   0.3   13   76-88      2-14  (50)
191 COG3091 SprT Zn-dependent meta  21.3      43 0.00094   22.3   0.6   10   75-84    140-149 (156)
192 PF06044 DRP:  Dam-replacing fa  21.1      42  0.0009   24.3   0.6   31   58-88     33-66  (254)
193 KOG0978 E3 ubiquitin ligase in  20.9      31 0.00066   28.9  -0.2   22   73-94    676-697 (698)
194 PLN02748 tRNA dimethylallyltra  20.8      62  0.0014   25.8   1.5   24   74-97    417-441 (468)
195 PF14369 zf-RING_3:  zinc-finge  20.7      65  0.0014   15.5   1.0   10   30-39     23-32  (35)
196 cd01121 Sms Sms (bacterial rad  20.7      65  0.0014   24.8   1.6   11   74-84     13-23  (372)
197 PF02748 PyrI_C:  Aspartate car  20.7      47   0.001   17.7   0.6   18   71-88     31-48  (52)
198 PRK03564 formate dehydrogenase  20.4      51  0.0011   24.8   0.9   50   25-83    184-234 (309)
199 PRK08222 hydrogenase 4 subunit  20.3      62  0.0014   22.1   1.3   21   74-94    113-133 (181)
200 COG1656 Uncharacterized conser  20.2      68  0.0015   21.7   1.4   23   74-96    129-151 (165)
201 PTZ00303 phosphatidylinositol   20.2      83  0.0018   27.1   2.1   13   76-88    461-473 (1374)
202 PRK04023 DNA polymerase II lar  20.1      84  0.0018   27.8   2.2   10   28-37    626-635 (1121)

No 1  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.92  E-value=7.5e-26  Score=157.83  Aligned_cols=124  Identities=23%  Similarity=0.294  Sum_probs=111.4

Q ss_pred             cchhcccCCCCCCCccccccccC---CCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc---------ccccc
Q 041414            2 ANCLMFMPHGGDFDAVNGVNMAV---ADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV---------DTQQS   69 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~h~---~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~---------~h~~~   69 (152)
                      ..||+++++.+.|.  +|.++|-   ..+.+.|++|+|.|.+-..|+.|+++|+  -+++|..|++         .|+++
T Consensus       134 ~eCgk~ysT~snLs--rHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  134 PECGKSYSTSSNLS--RHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             cccccccccccccc--hhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccccc
Confidence            46999999999999  9999993   3678999999999999999999999998  4788988886         89999


Q ss_pred             cCCCCceeccccccccccchHHHHHHhhccCCCccc-ccccccccCCCCCcchhhhccCcc
Q 041414           70 PVKPKTHECSVCGLEFAIGQALGGHMRRHRAGASHA-NEKLSAFSSLSDTAPLVEKANSRR  129 (152)
Q Consensus        70 h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~  129 (152)
                      |+|||||.|+.|+|+|...++|+.||++|.+.|.|. ..|+++|+...-+..+..+.-...
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~C~~~  270 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESACLKY  270 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhccccc
Confidence            999999999999999999999999999999999998 899999999887777766654433


No 2  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.84  E-value=3.1e-22  Score=139.83  Aligned_cols=92  Identities=22%  Similarity=0.340  Sum_probs=84.0

Q ss_pred             cchhcccCCCCCCCccccccccCCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc---------ccccccCC
Q 041414            2 ANCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV---------DTQQSPVK   72 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~---------~h~~~h~~   72 (152)
                      ..|+|.+.+-..|.  .|+++|+  -+++|.+|||.|....-|+.|+|+|+|+|||.|..|++         .|+++|++
T Consensus       165 ~~C~K~YvSmpALk--MHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  165 KYCGKVYVSMPALK--MHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             CCCCceeeehHHHh--hHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcC
Confidence            36889987777777  9999987  78999999999999999999999999999999999986         79999999


Q ss_pred             CCceeccccccccccchHHHHHHhh
Q 041414           73 PKTHECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      .|.|+|..|+|+|...+.|.+|...
T Consensus       241 ~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  241 VKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             CccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999999864


No 3  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.69  E-value=4.1e-18  Score=133.74  Aligned_cols=48  Identities=19%  Similarity=0.434  Sum_probs=44.5

Q ss_pred             chhcccCCCCCCCccccccccCCCcceecCcccccCCChhHHHHHHHhcC
Q 041414            3 NCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRASHK   52 (152)
Q Consensus         3 ~C~~~~~~~~~~~~~~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~   52 (152)
                      .|.|.|.+.+.|.  +|.+.||||+||.|++||..|..+.+|+.|...|.
T Consensus       358 ~CakvfgS~SaLq--iHlRSHTGERPfqCnvCG~~FSTkGNLKvH~~rH~  405 (958)
T KOG1074|consen  358 FCAKVFGSDSALQ--IHLRSHTGERPFQCNVCGNRFSTKGNLKVHFQRHR  405 (958)
T ss_pred             hhHhhcCchhhhh--hhhhccCCCCCeeecccccccccccceeeeeeecc
Confidence            5999999999988  99999999999999999999999999999976654


No 4  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.48  E-value=1.5e-15  Score=102.31  Aligned_cols=74  Identities=19%  Similarity=0.415  Sum_probs=58.8

Q ss_pred             CCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc---------ccccccCCCCceeccccccccccchHHHHH
Q 041414           24 VADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV---------DTQQSPVKPKTHECSVCGLEFAIGQALGGH   94 (152)
Q Consensus        24 ~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~---------~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H   94 (152)
                      .+...|.|.+|+|.|.....|.+|++-|...+.+-|..|++         +|.++|+|.+||+|..|+|+|.+...|..|
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            45566888888888888888888888887777776766665         777888888899999999999999889888


Q ss_pred             Hhh
Q 041414           95 MRR   97 (152)
Q Consensus        95 ~~~   97 (152)
                      ++.
T Consensus       193 l~k  195 (267)
T KOG3576|consen  193 LKK  195 (267)
T ss_pred             HHH
Confidence            763


No 5  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.45  E-value=1.1e-14  Score=113.53  Aligned_cols=73  Identities=19%  Similarity=0.383  Sum_probs=68.4

Q ss_pred             CCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc---------ccccccCCCCceeccccccccccchHHHHH
Q 041414           24 VADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV---------DTQQSPVKPKTHECSVCGLEFAIGQALGGH   94 (152)
Q Consensus        24 ~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~---------~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H   94 (152)
                      +.+..|.|+.|+|.|...++|.+|.--|+|.+||+|..|.+         .|+|.|+|||||.|..|+|.|...+...+|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQH  969 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQH  969 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhh
Confidence            56779999999999999999999999999999999999986         678999999999999999999999999999


Q ss_pred             Hh
Q 041414           95 MR   96 (152)
Q Consensus        95 ~~   96 (152)
                      |.
T Consensus       970 MN  971 (1007)
T KOG3623|consen  970 MN  971 (1007)
T ss_pred             hc
Confidence            96


No 6  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.43  E-value=1.6e-14  Score=113.82  Aligned_cols=82  Identities=24%  Similarity=0.474  Sum_probs=75.1

Q ss_pred             cchhcccCCCCCCCccccccccCCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceecc--
Q 041414            2 ANCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECS--   79 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~--   79 (152)
                      ..|.+.+++++.|+  .|.++|+||+||+|.+||++|..+.+|+.|+-+|...-++               .-+|.|+  
T Consensus       609 iiC~rVlSC~saLq--mHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~---------------R~q~ScP~~  671 (958)
T KOG1074|consen  609 IICLRVLSCPSALQ--MHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPA---------------RVQFSCPST  671 (958)
T ss_pred             eeeeecccchhhhh--hhhhcccCcCccccccccchhccccchhhcccccccCccc---------------cccccCCch
Confidence            46999999999999  9999999999999999999999999999999999776554               3579999  


Q ss_pred             -ccccccccchHHHHHHhhccC
Q 041414           80 -VCGLEFAIGQALGGHMRRHRA  100 (152)
Q Consensus        80 -~C~k~F~~~~~L~~H~~~h~~  100 (152)
                       +|-+.|...-.|.+|+++|.+
T Consensus       672 ~ic~~kftn~V~lpQhIriH~~  693 (958)
T KOG1074|consen  672 FICQKKFTNAVTLPQHIRIHLG  693 (958)
T ss_pred             hhhcccccccccccceEEeecC
Confidence             999999999999999999984


No 7  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.37  E-value=1.2e-13  Score=107.77  Aligned_cols=70  Identities=14%  Similarity=0.202  Sum_probs=62.6

Q ss_pred             CCCCCCCCCCc---------ccccccCCCCceeccccccccccchHHHHHHhhccCCCccc-ccccccccCCCCCcchhh
Q 041414           54 SRVTEGSGGGV---------DTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHRAGASHA-NEKLSAFSSLSDTAPLVE  123 (152)
Q Consensus        54 ~~~~~c~~~~~---------~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~-~~~~~~~~~~~~~~~~~~  123 (152)
                      .-+|.|+.|.+         +|..-|+|.+||+|.+|.|+|..+.+|..|+|.|.|+|||. ..|++.|+-+.+-+.++.
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            34688988875         88899999999999999999999999999999999999997 899999999877776654


No 8  
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.35  E-value=2.7e-14  Score=103.34  Aligned_cols=135  Identities=13%  Similarity=0.165  Sum_probs=95.4

Q ss_pred             cchhcccCCCCCCCccccccccCCCcceecCcccccCCChhHHHHHHHhcC--CCCCCCCCCC-----------------
Q 041414            2 ANCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRASHK--KSRVTEGSGG-----------------   62 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~--~~~~~~c~~~-----------------   62 (152)
                      |.|.+.|.++..|.  .|++.|++||...|+.||.-|..+..|-.|.+..+  ...+|.|..|                 
T Consensus       183 ~~Ct~~~~~k~~Lr--eH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH  260 (467)
T KOG3608|consen  183 AMCTKHMGNKYRLR--EHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH  260 (467)
T ss_pred             hhhhhhhccHHHHH--HHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh
Confidence            57888888888888  99999999999999999999998888888865432  3334444333                 


Q ss_pred             ---------Cc---------cccc-ccCCCCceeccccccccccchHHHHHHhhccCCCccc---ccccccccCCCCCcc
Q 041414           63 ---------GV---------DTQQ-SPVKPKTHECSVCGLEFAIGQALGGHMRRHRAGASHA---NEKLSAFSSLSDTAP  120 (152)
Q Consensus        63 ---------~~---------~h~~-~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~---~~~~~~~~~~~~~~~  120 (152)
                               ..         .|++ .|+..|||+|..|++.|.+.+.|.+|..+|. +..|.   +.|..++........
T Consensus       261 vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~  339 (467)
T KOG3608|consen  261 VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRR  339 (467)
T ss_pred             hhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHH
Confidence                     21         5554 5778899999999999999999999999888 55554   457666666555555


Q ss_pred             hhhhccCcceeecccCCCCCCCchh
Q 041414          121 LVEKANSRRVLCLDLNLTPYENDLE  145 (152)
Q Consensus       121 ~~~~~~~~~~~~~~~~~~p~~~d~~  145 (152)
                      +.+..+      ...|.++|-+-++
T Consensus       340 H~~evh------Eg~np~~Y~CH~C  358 (467)
T KOG3608|consen  340 HFLEVH------EGNNPILYACHCC  358 (467)
T ss_pred             HHHHhc------cCCCCCceeeecc
Confidence            544332      1233456666443


No 9  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.34  E-value=1.2e-13  Score=93.21  Aligned_cols=75  Identities=19%  Similarity=0.192  Sum_probs=64.9

Q ss_pred             CCCCCCCCCCCCc---------ccccccCCCCceeccccccccccchHHHHHHhhccCCCccc-ccccccccCCCCCcch
Q 041414           52 KKSRVTEGSGGGV---------DTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHRAGASHA-NEKLSAFSSLSDTAPL  121 (152)
Q Consensus        52 ~~~~~~~c~~~~~---------~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~-~~~~~~~~~~~~~~~~  121 (152)
                      .+...+.|..|++         +|++.|...|.|-|..|||.|...-.|++|+++|+|.+||. ..|+++|.+.-++..+
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            3445577888876         89999999999999999999999999999999999999998 8999999998877777


Q ss_pred             hhhcc
Q 041414          122 VEKAN  126 (152)
Q Consensus       122 ~~~~~  126 (152)
                      .++.+
T Consensus       193 l~kvh  197 (267)
T KOG3576|consen  193 LKKVH  197 (267)
T ss_pred             HHHHc
Confidence            66644


No 10 
>PHA00733 hypothetical protein
Probab=99.21  E-value=1.6e-11  Score=78.92  Aligned_cols=76  Identities=20%  Similarity=0.280  Sum_probs=50.2

Q ss_pred             chhcccCCCCCCCcc----ccccccCCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceec
Q 041414            3 NCLMFMPHGGDFDAV----NGVNMAVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHEC   78 (152)
Q Consensus         3 ~C~~~~~~~~~~~~~----~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C   78 (152)
                      .|.+.|.....|...    .|+.. .+++||.|+.|++.|.....|..|++.+                     +.+|.|
T Consensus        45 ~~~~~~~~~~~l~~~~~l~~~~~~-~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---------------------~~~~~C  102 (128)
T PHA00733         45 VVKTLIYNPQLLDESSYLYKLLTS-KAVSPYVCPLCLMPFSSSVSLKQHIRYT---------------------EHSKVC  102 (128)
T ss_pred             HHhhhccChhhhcchHHHHhhccc-CCCCCccCCCCCCcCCCHHHHHHHHhcC---------------------CcCccC
Confidence            355555555555422    33333 3467777888888887777777777654                     235788


Q ss_pred             cccccccccchHHHHHHhhccC
Q 041414           79 SVCGLEFAIGQALGGHMRRHRA  100 (152)
Q Consensus        79 ~~C~k~F~~~~~L~~H~~~h~~  100 (152)
                      ..|+++|.....|..|+...++
T Consensus       103 ~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        103 PVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCHHHHHHHHHHhcC
Confidence            8888888888888888776543


No 11 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.13  E-value=2.2e-11  Score=88.45  Aligned_cols=93  Identities=17%  Similarity=0.301  Sum_probs=73.0

Q ss_pred             cchhcccCCCCCCCccccccc-cCCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCC--CCc---------cccc-
Q 041414            2 ANCLMFMPHGGDFDAVNGVNM-AVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSG--GGV---------DTQQ-   68 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~-h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~--~~~---------~h~~-   68 (152)
                      ++|.|..+..++|.  .||+. |+..+||+|+.|++.|...+.|.+|..+|+ +-.|.|+.  |..         +|.+ 
T Consensus       267 plCdmtc~~~ssL~--~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~e  343 (467)
T KOG3608|consen  267 PLCDMTCSSASSLT--THIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLE  343 (467)
T ss_pred             cccccCCCChHHHH--HHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHH
Confidence            57888888888888  88875 778899999999999999999999988887 55677765  442         4443 


Q ss_pred             ccCCC--CceeccccccccccchHHHHHHhh
Q 041414           69 SPVKP--KTHECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        69 ~h~~~--k~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      .|.|.  .+|.|..|++.|.+..+|.+|+..
T Consensus       344 vhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~k  374 (467)
T KOG3608|consen  344 VHEGNNPILYACHCCDRFFTSGKSLSAHLMK  374 (467)
T ss_pred             hccCCCCCceeeecchhhhccchhHHHHHHH
Confidence            45443  469999999999999999999754


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.07  E-value=6.4e-11  Score=63.98  Aligned_cols=44  Identities=16%  Similarity=0.230  Sum_probs=38.6

Q ss_pred             ceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHH
Q 041414           28 AFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALG   92 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~   92 (152)
                      -|.|++||+.|...++|..|+++|+                     ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~---------------------k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN---------------------TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC---------------------CcccCCcccceecccceeE
Confidence            4799999999999999999999985                     3789999999999877653


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.89  E-value=3.6e-09  Score=82.54  Aligned_cols=83  Identities=14%  Similarity=0.222  Sum_probs=66.4

Q ss_pred             ceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc--------ccccccCCCCceecccccccccc----------ch
Q 041414           28 AFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV--------DTQQSPVKPKTHECSVCGLEFAI----------GQ   89 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~--------~h~~~h~~~k~~~C~~C~k~F~~----------~~   89 (152)
                      .+.|+.|++.|. ...|..|+.+++  +++.|. |+.        .|+..|.+++++.|..|++.|..          ..
T Consensus       453 H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s  528 (567)
T PLN03086        453 HVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVLEKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLR  528 (567)
T ss_pred             CccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCcchhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhh
Confidence            358999999996 678999999985  678887 754        78888999999999999999952          35


Q ss_pred             HHHHHHhhccCCCccc-ccccccccCC
Q 041414           90 ALGGHMRRHRAGASHA-NEKLSAFSSL  115 (152)
Q Consensus        90 ~L~~H~~~h~~~~~~~-~~~~~~~~~~  115 (152)
                      .|..|..++ |.+++. ..|++.+...
T Consensus       529 ~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr  554 (567)
T PLN03086        529 GMSEHESIC-GSRTAPCDSCGRSVMLK  554 (567)
T ss_pred             hHHHHHHhc-CCcceEccccCCeeeeh
Confidence            899999987 555554 7888776653


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.79  E-value=3.9e-09  Score=57.07  Aligned_cols=42  Identities=17%  Similarity=0.329  Sum_probs=35.5

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCccc-ccccccccCCCCC
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASHA-NEKLSAFSSLSDT  118 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~-~~~~~~~~~~~~~  118 (152)
                      .|+|+.||+.|...++|..|+++|+  +++. ..|++.|+.....
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            5899999999999999999999999  4554 8899988865443


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.78  E-value=7.4e-10  Score=51.38  Aligned_cols=23  Identities=13%  Similarity=0.596  Sum_probs=21.4

Q ss_pred             cccccccCCCcceecCcccccCC
Q 041414           17 VNGVNMAVADRAFECKTCNRQFP   39 (152)
Q Consensus        17 ~~h~~~h~~e~~~~C~~C~k~f~   39 (152)
                      ..||++|++++||.|++|++.|.
T Consensus         3 ~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    3 RRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHhhhcCCCCCCCCCCCcCeeC
Confidence            38999999999999999999986


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.73  E-value=9.1e-09  Score=47.65  Aligned_cols=26  Identities=31%  Similarity=0.590  Sum_probs=20.7

Q ss_pred             HHHHHHHhcCCCCCCCCCCCCcccccccCCCCceecccccccccc
Q 041414           43 ALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAI   87 (152)
Q Consensus        43 ~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~   87 (152)
                      +|.+|+++|++                   ++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~-------------------~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-------------------EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-------------------SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-------------------CCCCCCCCCcCeeCc
Confidence            46677777765                   889999999999964


No 17 
>PHA00733 hypothetical protein
Probab=98.65  E-value=6e-09  Score=67.08  Aligned_cols=87  Identities=15%  Similarity=0.105  Sum_probs=64.7

Q ss_pred             CCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHHHHHhhccCCCcc
Q 041414           25 ADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHRAGASH  104 (152)
Q Consensus        25 ~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~  104 (152)
                      ..+++.|.+|.+.|.....|..+.-...             ++. +.+++||.|..||+.|.....|..|+++|.. ...
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~-------------~~~-~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~-~~~  101 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYK-------------LLT-SKAVSPYVCPLCLMPFSSSVSLKQHIRYTEH-SKV  101 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHh-------------hcc-cCCCCCccCCCCCCcCCCHHHHHHHHhcCCc-Ccc
Confidence            4678999999999988877776622110             111 2237899999999999999999999997732 234


Q ss_pred             cccccccccCCCCCcchhhhcc
Q 041414          105 ANEKLSAFSSLSDTAPLVEKAN  126 (152)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~  126 (152)
                      +..|++.|.....+..++...+
T Consensus       102 C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733        102 CPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCCCCCccCCHHHHHHHHHHhc
Confidence            5899999999887777666544


No 18 
>PHA00732 hypothetical protein
Probab=98.60  E-value=3.3e-08  Score=58.16  Aligned_cols=47  Identities=26%  Similarity=0.537  Sum_probs=37.4

Q ss_pred             ceecCcccccCCChhHHHHHHHh-cCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHHHHHhhcc
Q 041414           28 AFECKTCNRQFPSFQALGGHRAS-HKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~-h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~   99 (152)
                      ||.|..|++.|....+|..|++. |.                      ++.|+.||+.|.   .|..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~----------------------~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT----------------------LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC----------------------CCccCCCCCEeC---ChhhhhcccC
Confidence            68899999999999999999874 43                      247999999998   4777876543


No 19 
>PHA00616 hypothetical protein
Probab=98.56  E-value=2.9e-08  Score=51.14  Aligned_cols=31  Identities=16%  Similarity=0.223  Sum_probs=28.8

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCccc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASHA  105 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~  105 (152)
                      ||+|+.||+.|...+.|..|++.|+|+++..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~   31 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLT   31 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccc
Confidence            6899999999999999999999999997754


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.48  E-value=9.4e-08  Score=74.77  Aligned_cols=86  Identities=16%  Similarity=0.322  Sum_probs=67.3

Q ss_pred             chhcccCCCCCCCccccccccCCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc------------------
Q 041414            3 NCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV------------------   64 (152)
Q Consensus         3 ~C~~~~~~~~~~~~~~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~------------------   64 (152)
                      .|++.|. ...+.  .|+.+|.  +++.|+ ||+.+ ....|..|+.+|...+++.|..|..                  
T Consensus       458 ~Cgk~f~-~s~Le--kH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~L  530 (567)
T PLN03086        458 KCGQAFQ-QGEME--KHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGM  530 (567)
T ss_pred             CCCCccc-hHHHH--HHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhH
Confidence            5777775 45565  8988874  899999 99765 5689999999999999999988865                  


Q ss_pred             -ccccccCCCCceeccccccccccchHHHHHHhh
Q 041414           65 -DTQQSPVKPKTHECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        65 -~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                       .|... .|.+++.|..||+.|.... |..|+..
T Consensus       531 t~HE~~-CG~rt~~C~~Cgk~Vrlrd-m~~H~~~  562 (567)
T PLN03086        531 SEHESI-CGSRTAPCDSCGRSVMLKE-MDIHQIA  562 (567)
T ss_pred             HHHHHh-cCCcceEccccCCeeeehh-HHHHHHH
Confidence             23333 4889999999999987654 6677654


No 21 
>PHA00616 hypothetical protein
Probab=98.48  E-value=5.9e-08  Score=50.02  Aligned_cols=32  Identities=19%  Similarity=0.260  Sum_probs=28.6

Q ss_pred             ceecCcccccCCChhHHHHHHHhcCCCCCCCC
Q 041414           28 AFECKTCNRQFPSFQALGGHRASHKKSRVTEG   59 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c   59 (152)
                      ||.|+.||+.|...+.|..|++.|++++++.+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            68999999999999999999999999766544


No 22 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.44  E-value=7.6e-08  Score=71.76  Aligned_cols=75  Identities=21%  Similarity=0.438  Sum_probs=52.1

Q ss_pred             cceecCcccccCCChhHHHHHHHhcCCCCCCC--C-CCCC------c---cccc--ccCCCCceeccccccccccchHHH
Q 041414           27 RAFECKTCNRQFPSFQALGGHRASHKKSRVTE--G-SGGG------V---DTQQ--SPVKPKTHECSVCGLEFAIGQALG   92 (152)
Q Consensus        27 ~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~--c-~~~~------~---~h~~--~h~~~k~~~C~~C~k~F~~~~~L~   92 (152)
                      .-|+|++|+|.|....+|..|+|+|.-.....  . ..-.      .   .-.+  ....+-.|.|..|+|.|.+...|+
T Consensus       294 vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLr  373 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLR  373 (500)
T ss_pred             eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHH
Confidence            35999999999999999999999995322111  0 0000      0   0000  012234899999999999999999


Q ss_pred             HHHhhccCC
Q 041414           93 GHMRRHRAG  101 (152)
Q Consensus        93 ~H~~~h~~~  101 (152)
                      .|+.+|...
T Consensus       374 KHqlthq~~  382 (500)
T KOG3993|consen  374 KHQLTHQRA  382 (500)
T ss_pred             HhHHhhhcc
Confidence            999887643


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.33  E-value=3.1e-07  Score=41.11  Aligned_cols=23  Identities=43%  Similarity=0.911  Sum_probs=21.6

Q ss_pred             eeccccccccccchHHHHHHhhc
Q 041414           76 HECSVCGLEFAIGQALGGHMRRH   98 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~h   98 (152)
                      |.|+.|++.|.....|.+|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999875


No 24 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.25  E-value=6.4e-07  Score=64.77  Aligned_cols=72  Identities=19%  Similarity=0.412  Sum_probs=51.3

Q ss_pred             CCCcceecCc--ccccCCChhHHHHHHHh-cCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHHHHHh
Q 041414           24 VADRAFECKT--CNRQFPSFQALGGHRAS-HKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHMR   96 (152)
Q Consensus        24 ~~e~~~~C~~--C~k~f~~~~~L~~h~~~-h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~   96 (152)
                      .++|||+|++  |.|+|.....|+.|+.- |..++..+-+.-. .+.-.....|||.|++|+|.+.....|+.|..
T Consensus       345 ~d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~-~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         345 KDGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPE-KMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             ecCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCcc-ccccccccCCceeccccchhhccCccceeccc
Confidence            4579999987  99999999999999763 4333222211100 11112345799999999999999999998865


No 25 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.13  E-value=1.8e-06  Score=64.61  Aligned_cols=50  Identities=18%  Similarity=0.422  Sum_probs=42.7

Q ss_pred             cchhcccCCCCCCCccccccccC--------CCc-------------------------ceecCcccccCCChhHHHHHH
Q 041414            2 ANCLMFMPHGGDFDAVNGVNMAV--------ADR-------------------------AFECKTCNRQFPSFQALGGHR   48 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~h~--------~e~-------------------------~~~C~~C~k~f~~~~~L~~h~   48 (152)
                      +.|+|.|+...+|.  .|.|+|.        +..                         -|.|.+|+|.|.....|+.|+
T Consensus       299 PEC~KVFsCPANLA--SHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHq  376 (500)
T KOG3993|consen  299 PECDKVFSCPANLA--SHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ  376 (500)
T ss_pred             CcccccccCchhhh--hhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhH
Confidence            57999999999999  9999983        222                         288999999999999999998


Q ss_pred             HhcCC
Q 041414           49 ASHKK   53 (152)
Q Consensus        49 ~~h~~   53 (152)
                      .+|..
T Consensus       377 lthq~  381 (500)
T KOG3993|consen  377 LTHQR  381 (500)
T ss_pred             Hhhhc
Confidence            88753


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.11  E-value=1.7e-06  Score=38.63  Aligned_cols=23  Identities=30%  Similarity=0.710  Sum_probs=21.3

Q ss_pred             eecCcccccCCChhHHHHHHHhc
Q 041414           29 FECKTCNRQFPSFQALGGHRASH   51 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~~h   51 (152)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999874


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.11  E-value=6.4e-06  Score=44.96  Aligned_cols=51  Identities=24%  Similarity=0.494  Sum_probs=38.7

Q ss_pred             ceecCcccccCCChhHHHHHHHh-cCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHHHHHhhcc
Q 041414           28 AFECKTCNRQFPSFQALGGHRAS-HKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~-h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~   99 (152)
                      .|.|++|++. .+...|..|... |..+                  .+.+.|++|...+.  .+|.+|+..++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~------------------~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSE------------------SKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCC------------------CCCccCCCchhhhh--hHHHHHHHHhc
Confidence            5899999995 556789999765 4432                  35789999998655  48999998754


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.99  E-value=4e-06  Score=38.96  Aligned_cols=26  Identities=38%  Similarity=0.645  Sum_probs=23.8

Q ss_pred             ceeccccccccccchHHHHHHhhccC
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRA  100 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~  100 (152)
                      ||+|..|++.|.....|..|++.|..
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999998753


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.97  E-value=5.1e-06  Score=37.20  Aligned_cols=24  Identities=38%  Similarity=0.832  Sum_probs=20.1

Q ss_pred             eeccccccccccchHHHHHHhhcc
Q 041414           76 HECSVCGLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~h~   99 (152)
                      |.|++|++.|.+...|..|+++|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            789999999999999999998763


No 30 
>PHA00732 hypothetical protein
Probab=97.90  E-value=8.3e-06  Score=48.00  Aligned_cols=38  Identities=24%  Similarity=0.411  Sum_probs=32.7

Q ss_pred             ceeccccccccccchHHHHHHhh-ccCCCcccccccccccC
Q 041414           75 THECSVCGLEFAIGQALGGHMRR-HRAGASHANEKLSAFSS  114 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~-h~~~~~~~~~~~~~~~~  114 (152)
                      ||.|..||+.|.+...|..|++. |.+.  .+..|+++|..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~~--~C~~CgKsF~~   39 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTLT--KCPVCNKSYRR   39 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCCC--ccCCCCCEeCC
Confidence            68999999999999999999984 6653  46899999984


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.75  E-value=2.3e-05  Score=47.88  Aligned_cols=70  Identities=20%  Similarity=0.349  Sum_probs=22.8

Q ss_pred             ecCcccccCCChhHHHHHHHhcCCCCCCCCCCC-Cc----ccccccCCCCceeccccccccccchHHHHHHhhccC
Q 041414           30 ECKTCNRQFPSFQALGGHRASHKKSRVTEGSGG-GV----DTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRHRA  100 (152)
Q Consensus        30 ~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~-~~----~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h~~  100 (152)
                      .|..|+..|.....|..|+...++...-..... ..    .+.+. .....+.|..|++.|.+...|..|++.+..
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~-~~~~~~~C~~C~~~f~s~~~l~~Hm~~~~H   75 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRK-KVKESFRCPYCNKTFRSREALQEHMRSKHH   75 (100)
T ss_dssp             -------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTTT
T ss_pred             Ccccccccccccccccccccccccccccccccccccccccccccc-ccCCCCCCCccCCCCcCHHHHHHHHcCccC
Confidence            488889998888888888865433211110000 00    11111 112369999999999999999999997543


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.71  E-value=1.8e-05  Score=36.68  Aligned_cols=25  Identities=44%  Similarity=0.897  Sum_probs=23.0

Q ss_pred             ceecCcccccCCChhHHHHHHHhcC
Q 041414           28 AFECKTCNRQFPSFQALGGHRASHK   52 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h~   52 (152)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999998774


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.69  E-value=3.3e-05  Score=34.44  Aligned_cols=23  Identities=35%  Similarity=0.756  Sum_probs=19.5

Q ss_pred             eecCcccccCCChhHHHHHHHhc
Q 041414           29 FECKTCNRQFPSFQALGGHRASH   51 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~~h   51 (152)
                      |.|++|++.|.....|..|+.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999999876


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.69  E-value=4.1e-05  Score=40.47  Aligned_cols=32  Identities=16%  Similarity=0.387  Sum_probs=23.6

Q ss_pred             CCCceeccccccccccchHHHHHHhhccCCCc
Q 041414           72 KPKTHECSVCGLEFAIGQALGGHMRRHRAGAS  103 (152)
Q Consensus        72 ~~k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~  103 (152)
                      .+.|-.|++|+..+.+..+|++|+.++++.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            36799999999999999999999998888765


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.56  E-value=5.6e-05  Score=34.19  Aligned_cols=25  Identities=40%  Similarity=0.675  Sum_probs=22.3

Q ss_pred             eeccccccccccchHHHHHHhhccC
Q 041414           76 HECSVCGLEFAIGQALGGHMRRHRA  100 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~h~~  100 (152)
                      |.|..|++.|.....|..|++.|..
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~~   25 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHXX   25 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhcc
Confidence            5799999999999999999997753


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.48  E-value=0.00013  Score=38.64  Aligned_cols=33  Identities=12%  Similarity=0.238  Sum_probs=23.6

Q ss_pred             CCCcceecCcccccCCChhHHHHHHHhcCCCCC
Q 041414           24 VADRAFECKTCNRQFPSFQALGGHRASHKKSRV   56 (152)
Q Consensus        24 ~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~   56 (152)
                      ..+.|..|++|+..+.+..+|.+|+.++++.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            467899999999999999999999988776554


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.27  E-value=0.00025  Score=31.89  Aligned_cols=24  Identities=33%  Similarity=0.693  Sum_probs=21.7

Q ss_pred             eecCcccccCCChhHHHHHHHhcC
Q 041414           29 FECKTCNRQFPSFQALGGHRASHK   52 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~~h~   52 (152)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998764


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.07  E-value=0.00034  Score=31.62  Aligned_cols=23  Identities=26%  Similarity=0.660  Sum_probs=21.0

Q ss_pred             eeccccccccccchHHHHHHhhc
Q 041414           76 HECSVCGLEFAIGQALGGHMRRH   98 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~h   98 (152)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            68999999999999999999764


No 39 
>PRK04860 hypothetical protein; Provisional
Probab=96.83  E-value=0.00084  Score=44.87  Aligned_cols=39  Identities=18%  Similarity=0.462  Sum_probs=30.3

Q ss_pred             cceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccccccc
Q 041414           27 RAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIG   88 (152)
Q Consensus        27 ~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~   88 (152)
                      -+|.|. |++   ...++.+|.++|.+                   +++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g-------------------~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRG-------------------EAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcC-------------------CccEECCCCCceeEEe
Confidence            478998 887   55678888888876                   6788888888887654


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.79  E-value=0.00091  Score=29.88  Aligned_cols=23  Identities=26%  Similarity=0.629  Sum_probs=18.4

Q ss_pred             eeccccccccccchHHHHHHhhcc
Q 041414           76 HECSVCGLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~h~   99 (152)
                      |+|+.|+.... ...|.+|+++|.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            78999998888 889999999865


No 41 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.77  E-value=0.00094  Score=50.77  Aligned_cols=56  Identities=16%  Similarity=0.354  Sum_probs=49.3

Q ss_pred             cchhcccCCCCCCCcccccc--ccCCC--cceecC--cccccCCChhHHHHHHHhcCCCCCCCC
Q 041414            2 ANCLMFMPHGGDFDAVNGVN--MAVAD--RAFECK--TCNRQFPSFQALGGHRASHKKSRVTEG   59 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~--~h~~e--~~~~C~--~C~k~f~~~~~L~~h~~~h~~~~~~~c   59 (152)
                      +.|...|+....+.  .|.+  .|+++  +|+.|+  .|++.|.....+..|...|.+..+..+
T Consensus       293 ~~~~~~~s~~~~l~--~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         293 KQCNISFSRSSPLT--RHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             ccccCCcccccccc--ccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            46788898898888  9999  89999  999999  799999999999999999988766553


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.70  E-value=0.00086  Score=30.21  Aligned_cols=23  Identities=39%  Similarity=0.716  Sum_probs=20.6

Q ss_pred             eecCcccccCCChhHHHHHHHhc
Q 041414           29 FECKTCNRQFPSFQALGGHRASH   51 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~~h   51 (152)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998753


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.54  E-value=0.00081  Score=31.03  Aligned_cols=22  Identities=27%  Similarity=0.558  Sum_probs=20.4

Q ss_pred             eeccccccccccchHHHHHHhh
Q 041414           76 HECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      |.|..|++.|.....|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999875


No 44 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=96.35  E-value=0.0032  Score=53.86  Aligned_cols=93  Identities=17%  Similarity=0.305  Sum_probs=63.6

Q ss_pred             cchhcccCCCCCCCcccccc-ccCCCcceecCcccccCCChhHHHHHHHh-cCCCCCCCCCCCCcccccc------cCCC
Q 041414            2 ANCLMFMPHGGDFDAVNGVN-MAVADRAFECKTCNRQFPSFQALGGHRAS-HKKSRVTEGSGGGVDTQQS------PVKP   73 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~-~h~~e~~~~C~~C~k~f~~~~~L~~h~~~-h~~~~~~~c~~~~~~h~~~------h~~~   73 (152)
                      .-|+..+.+.+.+.  .|+. .|+-.+.+.|+.|+..|+....|..|||. |...+.-.|.... .|.+.      -.+.
T Consensus       440 ~~~e~~~~s~r~~~--~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq-~~~~~arg~~~~~~~  516 (1406)
T KOG1146|consen  440 TKAEPLLESKRSLE--GQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQ-NHPRLARGEVYRCPG  516 (1406)
T ss_pred             cchhhhhhhhcccc--cceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhcc-ccccccccccccCCC
Confidence            34555666666555  5543 46667999999999999999999999987 3221111122111 22211      1235


Q ss_pred             CceeccccccccccchHHHHHHhh
Q 041414           74 KTHECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      ++|.|..|..++....+|.+|++.
T Consensus       517 ~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  517 KPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CcccceeeeeeeecchHHHHHHHH
Confidence            799999999999999999999874


No 45 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.92  E-value=0.006  Score=27.61  Aligned_cols=21  Identities=29%  Similarity=0.618  Sum_probs=17.3

Q ss_pred             eeccccccccccchHHHHHHhh
Q 041414           76 HECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      ..|+.||+.| ....|.+|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4799999999 56778889764


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.80  E-value=0.0068  Score=26.92  Aligned_cols=23  Identities=22%  Similarity=0.496  Sum_probs=18.0

Q ss_pred             eecCcccccCCChhHHHHHHHhcC
Q 041414           29 FECKTCNRQFPSFQALGGHRASHK   52 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~~h~   52 (152)
                      |.|+.|+.... ...|..|++.+.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            68999998887 889999998754


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.59  E-value=0.0036  Score=28.79  Aligned_cols=22  Identities=36%  Similarity=0.694  Sum_probs=19.6

Q ss_pred             eecCcccccCCChhHHHHHHHh
Q 041414           29 FECKTCNRQFPSFQALGGHRAS   50 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~~   50 (152)
                      |.|..|++.|.....+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999988764


No 48 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=95.43  E-value=0.013  Score=35.51  Aligned_cols=24  Identities=42%  Similarity=0.742  Sum_probs=21.1

Q ss_pred             ceecCcccccCCChhHHHHHHHhc
Q 041414           28 AFECKTCNRQFPSFQALGGHRASH   51 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h   51 (152)
                      .+.|.+|++.|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            589999999999999999999864


No 49 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=95.07  E-value=0.0078  Score=42.44  Aligned_cols=48  Identities=31%  Similarity=0.556  Sum_probs=38.1

Q ss_pred             eecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHHHH-Hhhcc
Q 041414           29 FECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGH-MRRHR   99 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H-~~~h~   99 (152)
                      -+|=+|++.|....-|.+|++                       .|.|+|.+|-|..-+...|..| |++|.
T Consensus        11 pwcwycnrefddekiliqhqk-----------------------akhfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQK-----------------------AKHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             ceeeecccccchhhhhhhhhh-----------------------hccceeeeehhhhccCCCceeehhhhhh
Confidence            468899999999988888876                       5679999999877777777776 45554


No 50 
>PRK04860 hypothetical protein; Provisional
Probab=94.95  E-value=0.019  Score=38.40  Aligned_cols=38  Identities=16%  Similarity=0.071  Sum_probs=32.0

Q ss_pred             CceeccccccccccchHHHHHHhhccCCCccc-ccccccccCC
Q 041414           74 KTHECSVCGLEFAIGQALGGHMRRHRAGASHA-NEKLSAFSSL  115 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~-~~~~~~~~~~  115 (152)
                      -+|.|. |++   ....+.+|.++|+++++|. ..|+..+...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            479998 997   7778899999999999887 6888877654


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.85  E-value=0.021  Score=27.70  Aligned_cols=23  Identities=17%  Similarity=0.541  Sum_probs=20.6

Q ss_pred             ceeccccccccccchHHHHHHhh
Q 041414           75 THECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      +|.|..|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999999999999864


No 52 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=94.74  E-value=0.031  Score=41.15  Aligned_cols=26  Identities=27%  Similarity=0.478  Sum_probs=23.3

Q ss_pred             CCCceeccc--cccccccchHHHHHHhh
Q 041414           72 KPKTHECSV--CGLEFAIGQALGGHMRR   97 (152)
Q Consensus        72 ~~k~~~C~~--C~k~F~~~~~L~~H~~~   97 (152)
                      ++|||+|++  |.|.+.....|+.|+.-
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lh  373 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLH  373 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhc
Confidence            369999998  99999999999999873


No 53 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.61  E-value=0.031  Score=27.08  Aligned_cols=23  Identities=30%  Similarity=0.576  Sum_probs=20.1

Q ss_pred             ceecCcccccCCChhHHHHHHHh
Q 041414           28 AFECKTCNRQFPSFQALGGHRAS   50 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~   50 (152)
                      +|.|++|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            68899999999999999888753


No 54 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=93.15  E-value=0.11  Score=28.09  Aligned_cols=35  Identities=23%  Similarity=0.325  Sum_probs=24.3

Q ss_pred             ceeccccccccccchHHHHHHhh-ccCCC-cc-cccccc
Q 041414           75 THECSVCGLEFAIGQALGGHMRR-HRAGA-SH-ANEKLS  110 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~-h~~~~-~~-~~~~~~  110 (152)
                      .|.|++|++. .....|..|... |..+. .+ ++.|..
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~   39 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSS   39 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchh
Confidence            4899999995 456789999765 65542 22 377764


No 55 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.99  E-value=0.055  Score=41.11  Aligned_cols=61  Identities=26%  Similarity=0.412  Sum_probs=46.0

Q ss_pred             ceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCC--Cceecc--ccccccccchHHHHHHhhccCCCc
Q 041414           28 AFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKP--KTHECS--VCGLEFAIGQALGGHMRRHRAGAS  103 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~--k~~~C~--~C~k~F~~~~~L~~H~~~h~~~~~  103 (152)
                      ++.|..|...|.....|..|.+.                 ..|.++  +++.|+  .|++.|.+...+.+|..+|.+..+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~-----------------~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~  351 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRS-----------------VNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP  351 (467)
T ss_pred             CCCCccccCCccccccccccccc-----------------cccccccCCceeeeccCCCccccccccccCCcccccCCCc
Confidence            56677777777777777666651                 034446  788888  799999999999999999988775


Q ss_pred             cc
Q 041414          104 HA  105 (152)
Q Consensus       104 ~~  105 (152)
                      ..
T Consensus       352 ~~  353 (467)
T COG5048         352 AK  353 (467)
T ss_pred             cc
Confidence            54


No 56 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.79  E-value=0.13  Score=27.82  Aligned_cols=28  Identities=18%  Similarity=0.362  Sum_probs=24.2

Q ss_pred             cCCCCceeccccccccccchHHHHHHhh
Q 041414           70 PVKPKTHECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        70 h~~~k~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      ..||.-+.|+.||..|.......+|...
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            4567889999999999999999999754


No 57 
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=88.53  E-value=0.39  Score=34.35  Aligned_cols=47  Identities=19%  Similarity=0.483  Sum_probs=35.3

Q ss_pred             ceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHHHHHh
Q 041414           28 AFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHMR   96 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~   96 (152)
                      -|.|.+||..... ..+.+|+-...+                    .-|.|..||+.|.. -....|..
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn--------------------~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN--------------------AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC--------------------CeeEEeeccccccc-chhhhhhh
Confidence            3789999998764 557778765443                    36999999999998 45667765


No 58 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=86.83  E-value=0.47  Score=22.79  Aligned_cols=10  Identities=40%  Similarity=0.973  Sum_probs=7.7

Q ss_pred             Cceecccccc
Q 041414           74 KTHECSVCGL   83 (152)
Q Consensus        74 k~~~C~~C~k   83 (152)
                      .++.|+.||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4788888874


No 59 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=86.79  E-value=0.61  Score=24.65  Aligned_cols=24  Identities=29%  Similarity=0.728  Sum_probs=19.1

Q ss_pred             eeccccccccccc-----hHHHHHHh-hcc
Q 041414           76 HECSVCGLEFAIG-----QALGGHMR-RHR   99 (152)
Q Consensus        76 ~~C~~C~k~F~~~-----~~L~~H~~-~h~   99 (152)
                      -.|..|++.+...     ++|.+|++ +|.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            5699999988665     69999998 564


No 60 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.71  E-value=0.22  Score=35.06  Aligned_cols=20  Identities=20%  Similarity=0.659  Sum_probs=15.5

Q ss_pred             CcceecCcccccCCChhHHH
Q 041414           26 DRAFECKTCNRQFPSFQALG   45 (152)
Q Consensus        26 e~~~~C~~C~k~f~~~~~L~   45 (152)
                      ++...|++|++.|..+.-..
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs   22 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRS   22 (214)
T ss_pred             CCceECCCCCCeeeeeEEEc
Confidence            46789999999998774333


No 61 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=85.75  E-value=0.48  Score=30.67  Aligned_cols=30  Identities=30%  Similarity=0.571  Sum_probs=19.0

Q ss_pred             CCceeccccccccccchHHHHHHhhccCCCccc
Q 041414           73 PKTHECSVCGLEFAIGQALGGHMRRHRAGASHA  105 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~  105 (152)
                      +..-.|-+||+.|..   |++|++.|.|-.+..
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gltp~e   99 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLTPEE   99 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-HHH
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCCHHH
Confidence            445789999999987   589999997766543


No 62 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=85.39  E-value=0.22  Score=40.80  Aligned_cols=28  Identities=29%  Similarity=0.511  Sum_probs=24.8

Q ss_pred             CceeccccccccccchHHHHHHhhccCC
Q 041414           74 KTHECSVCGLEFAIGQALGGHMRRHRAG  101 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H~~~h~~~  101 (152)
                      -.|.|.+|+|+|-....++.||++|.-.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            3599999999999999999999999643


No 63 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=84.06  E-value=0.53  Score=41.11  Aligned_cols=70  Identities=24%  Similarity=0.429  Sum_probs=45.4

Q ss_pred             CcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccccccchHHHHHHhhc
Q 041414           26 DRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHMRRH   98 (152)
Q Consensus        26 e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~h   98 (152)
                      ..+|.|..|...|.....|..|++.-  .+-.+.......+...+....+| |..|...|.....|..||++-
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~--~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~ 1351 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKF--CFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSS 1351 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHH--HhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHh
Confidence            34677777877777777777776211  00011111111344455556678 999999999999999999863


No 64 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=83.73  E-value=0.59  Score=25.32  Aligned_cols=32  Identities=13%  Similarity=0.199  Sum_probs=26.2

Q ss_pred             cccCCCcceecCcccccCCChhHHHHHHHhcC
Q 041414           21 NMAVADRAFECKTCNRQFPSFQALGGHRASHK   52 (152)
Q Consensus        21 ~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~   52 (152)
                      ...-||.-+.|+-||..|....++.+|....+
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            34567888999999999999999999976433


No 65 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=83.59  E-value=1.1  Score=22.85  Aligned_cols=24  Identities=25%  Similarity=0.574  Sum_probs=16.0

Q ss_pred             CCceeccccccccccc----hHHHHHHh
Q 041414           73 PKTHECSVCGLEFAIG----QALGGHMR   96 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~----~~L~~H~~   96 (152)
                      .....|..|++.+...    +.|.+|++
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            4567899999988764    78999984


No 66 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=83.08  E-value=0.94  Score=20.51  Aligned_cols=20  Identities=25%  Similarity=0.517  Sum_probs=15.8

Q ss_pred             eeccccccccccchHHHHHHh
Q 041414           76 HECSVCGLEFAIGQALGGHMR   96 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~   96 (152)
                      ..|++|++.+ ....++.|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3699999998 5577888875


No 67 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.12  E-value=0.9  Score=28.37  Aligned_cols=15  Identities=33%  Similarity=0.689  Sum_probs=12.7

Q ss_pred             Cceeccccccccccc
Q 041414           74 KTHECSVCGLEFAIG   88 (152)
Q Consensus        74 k~~~C~~C~k~F~~~   88 (152)
                      .|-.|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            578899999999876


No 68 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=78.57  E-value=1.5  Score=21.24  Aligned_cols=10  Identities=30%  Similarity=1.105  Sum_probs=7.0

Q ss_pred             Cceecccccc
Q 041414           74 KTHECSVCGL   83 (152)
Q Consensus        74 k~~~C~~C~k   83 (152)
                      .|..|++||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            4667888874


No 69 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=77.66  E-value=2.3  Score=23.42  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=8.6

Q ss_pred             CCceecccccc
Q 041414           73 PKTHECSVCGL   83 (152)
Q Consensus        73 ~k~~~C~~C~k   83 (152)
                      ..+|.|+.||.
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            45899999984


No 70 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=76.27  E-value=1.5  Score=22.69  Aligned_cols=12  Identities=25%  Similarity=0.733  Sum_probs=8.4

Q ss_pred             ceeccccccccc
Q 041414           75 THECSVCGLEFA   86 (152)
Q Consensus        75 ~~~C~~C~k~F~   86 (152)
                      ...|+.||..+.
T Consensus        21 ~~~Cp~CG~~~~   32 (46)
T PRK00398         21 GVRCPYCGYRIL   32 (46)
T ss_pred             ceECCCCCCeEE
Confidence            578888886544


No 71 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=76.18  E-value=1.1  Score=22.01  Aligned_cols=14  Identities=21%  Similarity=0.774  Sum_probs=10.5

Q ss_pred             eecCcccccCCChh
Q 041414           29 FECKTCNRQFPSFQ   42 (152)
Q Consensus        29 ~~C~~C~k~f~~~~   42 (152)
                      ..|+.|+..|.-..
T Consensus         3 ~~CP~C~~~~~v~~   16 (38)
T TIGR02098         3 IQCPNCKTSFRVVD   16 (38)
T ss_pred             EECCCCCCEEEeCH
Confidence            57888988887554


No 72 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=74.88  E-value=9.2  Score=24.05  Aligned_cols=74  Identities=15%  Similarity=0.107  Sum_probs=43.8

Q ss_pred             CcceecCcccccCCChhHHHHHHHhcCCCCCC------------CCCCCCcccccc-------cCCCCceeccccccccc
Q 041414           26 DRAFECKTCNRQFPSFQALGGHRASHKKSRVT------------EGSGGGVDTQQS-------PVKPKTHECSVCGLEFA   86 (152)
Q Consensus        26 e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~------------~c~~~~~~h~~~-------h~~~k~~~C~~C~k~F~   86 (152)
                      +-|-+|++||-.......|.+--..--.-++|            .|..|.......       -.....|+|+.|...|-
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC   92 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFC   92 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccccccccccceeCCCCCCccc
Confidence            45788999999998888888632110111111            133333211100       11233588999999888


Q ss_pred             cchHHHHHHhhcc
Q 041414           87 IGQALGGHMRRHR   99 (152)
Q Consensus        87 ~~~~L~~H~~~h~   99 (152)
                      ..-..-.|...|.
T Consensus        93 ~dCD~fiHe~Lh~  105 (112)
T TIGR00622        93 VDCDVFVHESLHC  105 (112)
T ss_pred             cccchhhhhhccC
Confidence            8877777877765


No 73 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=74.39  E-value=2.8  Score=24.97  Aligned_cols=31  Identities=23%  Similarity=0.338  Sum_probs=19.4

Q ss_pred             CCCCCCCCc-ccccccCCCCceeccccccccccc
Q 041414           56 VTEGSGGGV-DTQQSPVKPKTHECSVCGLEFAIG   88 (152)
Q Consensus        56 ~~~c~~~~~-~h~~~h~~~k~~~C~~C~k~F~~~   88 (152)
                      .+.|+.|+. .+.+.-+  ..|.|.-||..|.-.
T Consensus        35 ~~~Cp~C~~~~VkR~a~--GIW~C~kCg~~fAGg   66 (89)
T COG1997          35 KHVCPFCGRTTVKRIAT--GIWKCRKCGAKFAGG   66 (89)
T ss_pred             CCcCCCCCCcceeeecc--CeEEcCCCCCeeccc
Confidence            455666655 3333333  369999999998754


No 74 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=73.98  E-value=0.76  Score=32.71  Aligned_cols=42  Identities=24%  Similarity=0.391  Sum_probs=29.4

Q ss_pred             CCCCCccccccccCCCcceecCcccccCCChhHHHHH-HHhcC
Q 041414           11 GGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGH-RASHK   52 (152)
Q Consensus        11 ~~~~~~~~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h-~~~h~   52 (152)
                      .++|++..-+..|...|-|+|.+|.|.+-+-..|..| |++|.
T Consensus        17 nrefddekiliqhqkakhfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   17 NREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             ccccchhhhhhhhhhhccceeeeehhhhccCCCceeehhhhhh
Confidence            3445543333346667889999999998888888887 55663


No 75 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=73.08  E-value=3  Score=20.50  Aligned_cols=14  Identities=29%  Similarity=0.726  Sum_probs=10.3

Q ss_pred             CCceeccccccccc
Q 041414           73 PKTHECSVCGLEFA   86 (152)
Q Consensus        73 ~k~~~C~~C~k~F~   86 (152)
                      .+..+|+.|+..|.
T Consensus        23 ~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   23 GRKVRCPKCGHVFR   36 (37)
T ss_pred             CcEEECCCCCcEee
Confidence            34678888887774


No 76 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=72.65  E-value=2.6  Score=27.74  Aligned_cols=18  Identities=11%  Similarity=0.674  Sum_probs=13.0

Q ss_pred             CCcceecCcccccCCChh
Q 041414           25 ADRAFECKTCNRQFPSFQ   42 (152)
Q Consensus        25 ~e~~~~C~~C~k~f~~~~   42 (152)
                      +..-|.|+.|+..|....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLE  113 (147)
T ss_pred             CCcEEECcCCCCEeeHHH
Confidence            445688999998887543


No 77 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=70.71  E-value=2.3  Score=27.54  Aligned_cols=27  Identities=22%  Similarity=0.249  Sum_probs=21.9

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCcc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASH  104 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~  104 (152)
                      -..|-++|+.|.+   |++|+.+|.|-.|.
T Consensus        76 ~IicLEDGkkfKS---LKRHL~t~~gmTPd  102 (148)
T COG4957          76 YIICLEDGKKFKS---LKRHLTTHYGLTPD  102 (148)
T ss_pred             eEEEeccCcchHH---HHHHHhcccCCCHH
Confidence            3569999999985   89999999876553


No 78 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=70.71  E-value=3.1  Score=27.84  Aligned_cols=21  Identities=19%  Similarity=0.295  Sum_probs=14.0

Q ss_pred             CCCcceecCcccccCCChhHH
Q 041414           24 VADRAFECKTCNRQFPSFQAL   44 (152)
Q Consensus        24 ~~e~~~~C~~C~k~f~~~~~L   44 (152)
                      ++..-|.|+.|+..|+....+
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHH
Confidence            344567788888777766554


No 79 
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=69.85  E-value=1.4  Score=33.17  Aligned_cols=69  Identities=20%  Similarity=0.369  Sum_probs=41.0

Q ss_pred             CcceecCc--ccccCCChhHHHHHHHhcCCCCCCC-CCCCCcccccccCCCCceeccccccccccchHHHHHH
Q 041414           26 DRAFECKT--CNRQFPSFQALGGHRASHKKSRVTE-GSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGHM   95 (152)
Q Consensus        26 e~~~~C~~--C~k~f~~~~~L~~h~~~h~~~~~~~-c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~   95 (152)
                      .++|+|.+  |.+.+.....|+.|...-+.. +.. ...-..-|.-.....|+|+|++|.+.+.....|+.|.
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s-~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCS-PITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCC-CCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            46788854  888888777777664321110 000 0001113444445579999999998888776665543


No 80 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=69.78  E-value=4  Score=22.47  Aligned_cols=11  Identities=27%  Similarity=0.887  Sum_probs=8.5

Q ss_pred             CCceecccccc
Q 041414           73 PKTHECSVCGL   83 (152)
Q Consensus        73 ~k~~~C~~C~k   83 (152)
                      ..+|.|+.||.
T Consensus        46 ~~~Y~CP~CGF   56 (59)
T PRK14890         46 SNPYTCPKCGF   56 (59)
T ss_pred             CCceECCCCCC
Confidence            35799999984


No 81 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=68.94  E-value=3.2  Score=28.35  Aligned_cols=20  Identities=25%  Similarity=0.516  Sum_probs=13.3

Q ss_pred             CCcceecCcccccCCChhHH
Q 041414           25 ADRAFECKTCNRQFPSFQAL   44 (152)
Q Consensus        25 ~e~~~~C~~C~k~f~~~~~L   44 (152)
                      +..-|.|+.|+..|+....+
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAM  133 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHh
Confidence            34567888888887765543


No 82 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=68.44  E-value=4.1  Score=25.24  Aligned_cols=70  Identities=14%  Similarity=0.263  Sum_probs=43.7

Q ss_pred             cceecCcccccCCChhHHHHHHHh-cCCCCC------------CC---CCC-------CCc---ccccccCCCCceec--
Q 041414           27 RAFECKTCNRQFPSFQALGGHRAS-HKKSRV------------TE---GSG-------GGV---DTQQSPVKPKTHEC--   78 (152)
Q Consensus        27 ~~~~C~~C~k~f~~~~~L~~h~~~-h~~~~~------------~~---c~~-------~~~---~h~~~h~~~k~~~C--   78 (152)
                      +-..|..|+-+... +.+..|.+. |.....            +.   ...       -..   ..+.++   .-|.|  
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~---~G~~C~~   85 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVY---DGYRCQC   85 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCC---CCeeeec
Confidence            45678899887765 778888874 322111            00   000       000   222222   34899  


Q ss_pred             --cccccccccchHHHHHHhhccC
Q 041414           79 --SVCGLEFAIGQALGGHMRRHRA  100 (152)
Q Consensus        79 --~~C~k~F~~~~~L~~H~~~h~~  100 (152)
                        ..|+..+.+...+.+|++.++|
T Consensus        86 ~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   86 DPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCCCcEeccHHHHHHHHHHhcC
Confidence              9999999999999999987654


No 83 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=67.98  E-value=3.4  Score=26.50  Aligned_cols=20  Identities=20%  Similarity=0.243  Sum_probs=14.7

Q ss_pred             CCceeccccccccccchHHH
Q 041414           73 PKTHECSVCGLEFAIGQALG   92 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~   92 (152)
                      ..|-.|+.||..|.....++
T Consensus        24 k~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300        24 RRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             CCCccCCCcCCccCcchhhc
Confidence            35788999999987664444


No 84 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=67.49  E-value=3.9  Score=21.06  Aligned_cols=13  Identities=23%  Similarity=0.636  Sum_probs=9.6

Q ss_pred             ceecCcccccCCC
Q 041414           28 AFECKTCNRQFPS   40 (152)
Q Consensus        28 ~~~C~~C~k~f~~   40 (152)
                      .|.|..||..|..
T Consensus         2 ~Y~C~~Cg~~~~~   14 (44)
T smart00659        2 IYICGECGRENEI   14 (44)
T ss_pred             EEECCCCCCEeec
Confidence            3788888887753


No 85 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=66.98  E-value=4.3  Score=28.62  Aligned_cols=29  Identities=14%  Similarity=0.368  Sum_probs=22.2

Q ss_pred             CCCcceecCcccccCCChhHHHHHHHhcC
Q 041414           24 VADRAFECKTCNRQFPSFQALGGHRASHK   52 (152)
Q Consensus        24 ~~e~~~~C~~C~k~f~~~~~L~~h~~~h~   52 (152)
                      .++..|.|..|+|.|.-...+..|+..-+
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcC
Confidence            45667999999999999999999987643


No 86 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=65.88  E-value=1.2  Score=36.72  Aligned_cols=26  Identities=23%  Similarity=0.694  Sum_probs=23.3

Q ss_pred             ceecCcccccCCChhHHHHHHHhcCC
Q 041414           28 AFECKTCNRQFPSFQALGGHRASHKK   53 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~h~~   53 (152)
                      -|.|.+|+|.|-...++..||++|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            38999999999999999999999853


No 87 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=65.46  E-value=5  Score=26.41  Aligned_cols=22  Identities=18%  Similarity=0.314  Sum_probs=17.5

Q ss_pred             CCceeccccccccccchHHHHH
Q 041414           73 PKTHECSVCGLEFAIGQALGGH   94 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H   94 (152)
                      +.-|.|+.||+.|...++..+-
T Consensus       122 ~~f~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen  122 DEFWRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             CeEEECCCCCCEecccccHHHH
Confidence            3468999999999988876543


No 88 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=65.10  E-value=4.8  Score=26.85  Aligned_cols=18  Identities=28%  Similarity=0.691  Sum_probs=13.9

Q ss_pred             CceeccccccccccchHH
Q 041414           74 KTHECSVCGLEFAIGQAL   91 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L   91 (152)
                      +.+.|+.||+.|.....+
T Consensus        27 ~~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         27 RRRECLACGKRFTTFERV   44 (154)
T ss_pred             eeeeccccCCcceEeEec
Confidence            348999999999876544


No 89 
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=63.91  E-value=4.3  Score=29.27  Aligned_cols=40  Identities=23%  Similarity=0.359  Sum_probs=33.6

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCcccccccccccCC
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASHANEKLSAFSSL  115 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~  115 (152)
                      -|.|..||.... +..+.+|+-.-++....+-.|+..|...
T Consensus         3 ~FtCnvCgEsvK-Kp~vekH~srCrn~~fSCIDC~k~F~~~   42 (276)
T KOG2186|consen    3 FFTCNVCGESVK-KPQVEKHMSRCRNAYFSCIDCGKTFERV   42 (276)
T ss_pred             EEehhhhhhhcc-ccchHHHHHhccCCeeEEeecccccccc
Confidence            488999998876 4568889999888888789999999884


No 90 
>PHA00626 hypothetical protein
Probab=63.71  E-value=6.9  Score=21.29  Aligned_cols=15  Identities=20%  Similarity=0.417  Sum_probs=12.1

Q ss_pred             Cceeccccccccccc
Q 041414           74 KTHECSVCGLEFAIG   88 (152)
Q Consensus        74 k~~~C~~C~k~F~~~   88 (152)
                      ..|+|+.||..|+..
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            469999999888743


No 91 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=63.52  E-value=3.3  Score=18.40  Aligned_cols=10  Identities=30%  Similarity=0.919  Sum_probs=8.0

Q ss_pred             Cceecccccc
Q 041414           74 KTHECSVCGL   83 (152)
Q Consensus        74 k~~~C~~C~k   83 (152)
                      ..|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4699999984


No 92 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=62.43  E-value=6  Score=19.77  Aligned_cols=18  Identities=33%  Similarity=0.444  Sum_probs=11.0

Q ss_pred             ccccCCCCceeccccccc
Q 041414           67 QQSPVKPKTHECSVCGLE   84 (152)
Q Consensus        67 ~~~h~~~k~~~C~~C~k~   84 (152)
                      .....+.+.|.|..|+..
T Consensus        16 ~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen   16 CQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             SEEETTTTEEEETTT--E
T ss_pred             ceEcCCCCEEECcCCCCc
Confidence            334445678999999864


No 93 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=62.35  E-value=3.6  Score=20.33  Aligned_cols=30  Identities=20%  Similarity=0.306  Sum_probs=19.5

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCcccccccc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASHANEKLS  110 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~~~~~~  110 (152)
                      .|+|..||..|......      ..++...++.|+.
T Consensus         5 ~y~C~~Cg~~fe~~~~~------~~~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKI------SDDPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEec------CCCCCCCCCCCCC
Confidence            48999999988754332      1244555577765


No 94 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=62.32  E-value=9.3  Score=31.59  Aligned_cols=25  Identities=24%  Similarity=0.331  Sum_probs=15.9

Q ss_pred             eccccccccccchHHHHHHhhccCC
Q 041414           77 ECSVCGLEFAIGQALGGHMRRHRAG  101 (152)
Q Consensus        77 ~C~~C~k~F~~~~~L~~H~~~h~~~  101 (152)
                      .|..|..-|-....|.+|++.++..
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h~~  208 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDHEF  208 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccceeh
Confidence            4666666677677777777654443


No 95 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=61.01  E-value=3.7  Score=26.59  Aligned_cols=20  Identities=15%  Similarity=0.476  Sum_probs=14.3

Q ss_pred             ccCCCcceecCcccccCCCh
Q 041414           22 MAVADRAFECKTCNRQFPSF   41 (152)
Q Consensus        22 ~h~~e~~~~C~~C~k~f~~~   41 (152)
                      +-++.+-|+|++|..+....
T Consensus        74 vF~d~~lYeCnIC~etS~ee   93 (140)
T PF05290_consen   74 VFLDPKLYECNICKETSAEE   93 (140)
T ss_pred             eecCCCceeccCcccccchh
Confidence            34566789999998876543


No 96 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=59.89  E-value=4.2  Score=20.61  Aligned_cols=30  Identities=27%  Similarity=0.406  Sum_probs=19.1

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCcccccccc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASHANEKLS  110 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~~~~~~  110 (152)
                      .|.|..||..|.....+      .......++.|+.
T Consensus         5 ey~C~~Cg~~fe~~~~~------~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSI------SEDDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEEc------CCCCCCcCCCCCC
Confidence            48999999999865432      2234444566664


No 97 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=59.60  E-value=5.4  Score=26.94  Aligned_cols=23  Identities=22%  Similarity=0.351  Sum_probs=14.0

Q ss_pred             CCCCCCCCcccccccCCCCceeccccc
Q 041414           56 VTEGSGGGVDTQQSPVKPKTHECSVCG   82 (152)
Q Consensus        56 ~~~c~~~~~~h~~~h~~~k~~~C~~C~   82 (152)
                      .|.|..|+..+    .|+-|..||+||
T Consensus       134 ~~vC~vCGy~~----~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTH----EGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcc----cCCCCCcCCCCC
Confidence            35566555432    346677888887


No 98 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=59.41  E-value=6  Score=22.78  Aligned_cols=19  Identities=21%  Similarity=0.602  Sum_probs=14.4

Q ss_pred             CCceecc--ccccccccchHH
Q 041414           73 PKTHECS--VCGLEFAIGQAL   91 (152)
Q Consensus        73 ~k~~~C~--~C~k~F~~~~~L   91 (152)
                      ++-+.|.  .||..|.....+
T Consensus        25 ~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             eeeeecCCCCCCCEEEEEEEE
Confidence            5678898  899999875443


No 99 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=59.32  E-value=5.7  Score=28.81  Aligned_cols=76  Identities=24%  Similarity=0.334  Sum_probs=44.8

Q ss_pred             cCCCcceecCcccccCCChhHHHHHHHhc--CCCCCCCCCCCCc---------------ccccc----cCCCCceecccc
Q 041414           23 AVADRAFECKTCNRQFPSFQALGGHRASH--KKSRVTEGSGGGV---------------DTQQS----PVKPKTHECSVC   81 (152)
Q Consensus        23 h~~e~~~~C~~C~k~f~~~~~L~~h~~~h--~~~~~~~c~~~~~---------------~h~~~----h~~~k~~~C~~C   81 (152)
                      ..|.+-|.|..|...+-....+ .|+..-  .....|+|..|..               .|.+.    ....+++.|+.|
T Consensus       137 ~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKC  215 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKC  215 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCC
Confidence            3467889999998765544333 355432  1223455544432               34332    234578999999


Q ss_pred             ccccccchHHHHHHhhcc
Q 041414           82 GLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        82 ~k~F~~~~~L~~H~~~h~   99 (152)
                      |........|..-.++|.
T Consensus       216 g~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  216 GYETQETKDLSMSTRSHK  233 (314)
T ss_pred             CCcccccccceeeeecch
Confidence            987777777765555553


No 100
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=58.51  E-value=5.4  Score=30.46  Aligned_cols=70  Identities=24%  Similarity=0.401  Sum_probs=43.8

Q ss_pred             ceecCcccccCCChhHHHHHHHh--cC---CCCCCCCC-----CCCcccc--------cccCCCCceeccccccccccch
Q 041414           28 AFECKTCNRQFPSFQALGGHRAS--HK---KSRVTEGS-----GGGVDTQ--------QSPVKPKTHECSVCGLEFAIGQ   89 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~--h~---~~~~~~c~-----~~~~~h~--------~~h~~~k~~~C~~C~k~F~~~~   89 (152)
                      -|+|.-|...|.....-+.|.++  |.   ..+...=+     .+...+.        ..-.++-++.|..|.+.|....
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            37899999999988777777764  21   11111000     0000010        0123455799999999999999


Q ss_pred             HHHHHHhh
Q 041414           90 ALGGHMRR   97 (152)
Q Consensus        90 ~L~~H~~~   97 (152)
                      .-..|++.
T Consensus        83 a~~~hl~S   90 (390)
T KOG2785|consen   83 AHENHLKS   90 (390)
T ss_pred             hHHHHHHH
Confidence            98889864


No 101
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=58.38  E-value=4.5  Score=18.28  Aligned_cols=11  Identities=36%  Similarity=1.041  Sum_probs=8.4

Q ss_pred             eeccccccccc
Q 041414           76 HECSVCGLEFA   86 (152)
Q Consensus        76 ~~C~~C~k~F~   86 (152)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            46888888875


No 102
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=56.70  E-value=14  Score=28.30  Aligned_cols=68  Identities=18%  Similarity=0.215  Sum_probs=46.0

Q ss_pred             cceecCcccccCCChhHHHHHHHhcCCCCC----CCCCCCCcccccccCC---CCceeccccc---cccccchHHHHHHh
Q 041414           27 RAFECKTCNRQFPSFQALGGHRASHKKSRV----TEGSGGGVDTQQSPVK---PKTHECSVCG---LEFAIGQALGGHMR   96 (152)
Q Consensus        27 ~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~----~~c~~~~~~h~~~h~~---~k~~~C~~C~---k~F~~~~~L~~H~~   96 (152)
                      -|-.|-.|++.+..-..-..||..++|-.-    |.-+.-+   +....|   ..-|.|-.|+   +.|.+....+.||.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~G---Ll~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKG---LLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhH---HHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            467899999999988888889988877321    1100000   000111   2358899998   99999999999996


Q ss_pred             h
Q 041414           97 R   97 (152)
Q Consensus        97 ~   97 (152)
                      .
T Consensus       242 ~  242 (390)
T KOG2785|consen  242 D  242 (390)
T ss_pred             h
Confidence            3


No 103
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=56.48  E-value=4.7  Score=24.27  Aligned_cols=15  Identities=27%  Similarity=0.423  Sum_probs=12.2

Q ss_pred             Cceeccccccccccc
Q 041414           74 KTHECSVCGLEFAIG   88 (152)
Q Consensus        74 k~~~C~~C~k~F~~~   88 (152)
                      -.|.|..|++.|.-.
T Consensus        53 GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         53 GIWRCKGCKKTVAGG   67 (90)
T ss_pred             EEEEcCCCCCEEeCC
Confidence            479999999998753


No 104
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=56.11  E-value=4.4  Score=28.56  Aligned_cols=25  Identities=20%  Similarity=0.425  Sum_probs=20.0

Q ss_pred             CCceeccccccccccchHHHHHHhh
Q 041414           73 PKTHECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      +.-|.|..|+|.|.-..-...|+..
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhh
Confidence            4569999999999999999999875


No 105
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=56.10  E-value=8.3  Score=19.92  Aligned_cols=22  Identities=23%  Similarity=0.348  Sum_probs=18.0

Q ss_pred             eeccccccccccchHHHHHHhh
Q 041414           76 HECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      |+|-.|..+-..++.|-.||+-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            6788888777888999999874


No 106
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=55.53  E-value=3.6  Score=28.74  Aligned_cols=84  Identities=21%  Similarity=0.377  Sum_probs=51.5

Q ss_pred             cchhcccCCCCCCCccccccccCCCcceecCcccccCCChhHHHHHHHh-cCCCCCCCCCCCCcccccccCCCCceeccc
Q 041414            2 ANCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQFPSFQALGGHRAS-HKKSRVTEGSGGGVDTQQSPVKPKTHECSV   80 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~h~~e~~~~C~~C~k~f~~~~~L~~h~~~-h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~   80 (152)
                      |.|-..|.....+.  .|..+-   ....|.+|.+.|.+..-|..|+.- |..-  |        ...+-.|.--|+|-+
T Consensus        85 agc~~~~d~lD~~E--~hY~~~---h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~--F--------qa~veRG~dMy~Clv  149 (253)
T KOG4173|consen   85 AGCCQVFDALDDYE--HHYHTL---HGNSCSFCKRAFPTGHLLDAHILEWHDSL--F--------QALVERGQDMYQCLV  149 (253)
T ss_pred             cchHHHHhhhhhHH--Hhhhhc---ccchhHHHHHhCCchhhhhHHHHHHHHHH--H--------HHHHHcCccHHHHHH
Confidence            44555565555554  332221   124799999999998888888742 3210  0        001122334588854


Q ss_pred             --cccccccchHHHHHHh-hccC
Q 041414           81 --CGLEFAIGQALGGHMR-RHRA  100 (152)
Q Consensus        81 --C~k~F~~~~~L~~H~~-~h~~  100 (152)
                        |+..|.+....+.|+- +|.-
T Consensus       150 EgCt~KFkT~r~RkdH~I~~Hk~  172 (253)
T KOG4173|consen  150 EGCTEKFKTSRDRKDHMIRMHKY  172 (253)
T ss_pred             HhhhhhhhhhhhhhhHHHHhccC
Confidence              9999999999999974 4643


No 107
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=53.74  E-value=6.7  Score=23.99  Aligned_cols=19  Identities=16%  Similarity=0.426  Sum_probs=14.8

Q ss_pred             cccCCCcceecCcccccCCC
Q 041414           21 NMAVADRAFECKTCNRQFPS   40 (152)
Q Consensus        21 ~~h~~e~~~~C~~C~k~f~~   40 (152)
                      ..+.| +|+.|.+||..|.-
T Consensus        73 ~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          73 WLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEeCC-CceeCCCCCcEEEE
Confidence            34556 79999999998863


No 108
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=52.63  E-value=7  Score=19.48  Aligned_cols=14  Identities=29%  Similarity=0.567  Sum_probs=12.0

Q ss_pred             ceeccccccccccc
Q 041414           75 THECSVCGLEFAIG   88 (152)
Q Consensus        75 ~~~C~~C~k~F~~~   88 (152)
                      ||+|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            89999999998753


No 109
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=52.01  E-value=3.9  Score=24.60  Aligned_cols=13  Identities=38%  Similarity=0.815  Sum_probs=10.7

Q ss_pred             ceecccccccccc
Q 041414           75 THECSVCGLEFAI   87 (152)
Q Consensus        75 ~~~C~~C~k~F~~   87 (152)
                      .|.|..|++.|.-
T Consensus        53 IW~C~~C~~~~AG   65 (90)
T PF01780_consen   53 IWKCKKCGKKFAG   65 (90)
T ss_dssp             EEEETTTTEEEE-
T ss_pred             EeecCCCCCEEeC
Confidence            5999999999864


No 110
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=51.20  E-value=14  Score=22.78  Aligned_cols=25  Identities=16%  Similarity=0.357  Sum_probs=21.9

Q ss_pred             eec----CcccccCCChhHHHHHHHhcCC
Q 041414           29 FEC----KTCNRQFPSFQALGGHRASHKK   53 (152)
Q Consensus        29 ~~C----~~C~k~f~~~~~L~~h~~~h~~   53 (152)
                      |.|    ..|+....+...|..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999887653


No 111
>PLN02294 cytochrome c oxidase subunit Vb
Probab=50.95  E-value=8.2  Score=26.14  Aligned_cols=20  Identities=30%  Similarity=0.509  Sum_probs=15.0

Q ss_pred             cccCCCCceeccccccccccc
Q 041414           68 QSPVKPKTHECSVCGLEFAIG   88 (152)
Q Consensus        68 ~~h~~~k~~~C~~C~k~F~~~   88 (152)
                      ..+.| +|+.|++||..|.-.
T Consensus       135 ~L~kG-kp~RCpeCG~~fkL~  154 (174)
T PLN02294        135 WLEKG-KSFECPVCTQYFELE  154 (174)
T ss_pred             EecCC-CceeCCCCCCEEEEE
Confidence            34444 699999999998743


No 112
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.32  E-value=7.5  Score=24.26  Aligned_cols=15  Identities=7%  Similarity=0.051  Sum_probs=12.2

Q ss_pred             CCceecccccccccc
Q 041414           73 PKTHECSVCGLEFAI   87 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~   87 (152)
                      ..|-.|+.||++|..
T Consensus        24 rdPiVsPytG~s~P~   38 (129)
T COG4530          24 RDPIVSPYTGKSYPR   38 (129)
T ss_pred             CCccccCcccccchH
Confidence            458889999999954


No 113
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=50.11  E-value=7.4  Score=20.44  Aligned_cols=30  Identities=20%  Similarity=0.359  Sum_probs=19.0

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCcccccccc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASHANEKLS  110 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~~~~~~  110 (152)
                      -|.|..||..|.....+      .......++.|+.
T Consensus         5 ey~C~~Cg~~fe~~~~~------~~~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKM------SDDPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEec------CCCCCCCCCCCCC
Confidence            48999999999854322      1133444577775


No 114
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=49.39  E-value=47  Score=25.40  Aligned_cols=69  Identities=20%  Similarity=0.277  Sum_probs=42.8

Q ss_pred             ecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc-ccc--------cccCCCCceeccc--c--c--cccccchHHHHH
Q 041414           30 ECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV-DTQ--------QSPVKPKTHECSV--C--G--LEFAIGQALGGH   94 (152)
Q Consensus        30 ~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~-~h~--------~~h~~~k~~~C~~--C--~--k~F~~~~~L~~H   94 (152)
                      .|..|...|-....|..|++..+. +-+.|+.-.. .|+        ..|-..-.|.|.+  |  |  ..|.....|..|
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE-~ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy~ct~qtc~~~k~~vf~~~~el~~h  300 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE-ACHICDMVGPIRYQYFKSYEDLEAHFRNAHYCCTFQTCRVGKCYVFPYHTELLEH  300 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh-hhhhhhccCccchhhhhCHHHHHHHhhcCceEEEEEEEecCcEEEeccHHHHHHH
Confidence            599999999999999999986432 2333332221 222        2233344566654  4  2  367778888888


Q ss_pred             Hhhcc
Q 041414           95 MRRHR   99 (152)
Q Consensus        95 ~~~h~   99 (152)
                      +..-+
T Consensus       301 ~~~~h  305 (493)
T COG5236         301 LTRFH  305 (493)
T ss_pred             HHHHh
Confidence            76533


No 115
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=49.35  E-value=11  Score=24.03  Aligned_cols=25  Identities=24%  Similarity=0.376  Sum_probs=22.0

Q ss_pred             CCceeccccccccccchHHHHHHhh
Q 041414           73 PKTHECSVCGLEFAIGQALGGHMRR   97 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H~~~   97 (152)
                      .-.|-|-.|.+-|.....|..|.++
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            4469999999999999999999864


No 116
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=48.71  E-value=6.4  Score=23.75  Aligned_cols=14  Identities=43%  Similarity=0.897  Sum_probs=11.7

Q ss_pred             ceeccccccccccc
Q 041414           75 THECSVCGLEFAIG   88 (152)
Q Consensus        75 ~~~C~~C~k~F~~~   88 (152)
                      .|.|..|++.|.-.
T Consensus        53 IW~C~~C~~~~AGG   66 (91)
T TIGR00280        53 IWTCRKCGAKFAGG   66 (91)
T ss_pred             EEEcCCCCCEEeCC
Confidence            69999999998743


No 117
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=48.60  E-value=9.2  Score=23.02  Aligned_cols=14  Identities=36%  Similarity=0.831  Sum_probs=8.1

Q ss_pred             cceecCcccccCCC
Q 041414           27 RAFECKTCNRQFPS   40 (152)
Q Consensus        27 ~~~~C~~C~k~f~~   40 (152)
                      +|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            35566666666643


No 118
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=48.37  E-value=11  Score=29.74  Aligned_cols=21  Identities=29%  Similarity=0.512  Sum_probs=19.2

Q ss_pred             eeccccccccccchHHHHHHh
Q 041414           76 HECSVCGLEFAIGQALGGHMR   96 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~~   96 (152)
                      +-|.+|+++|.+..+|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            889999999999999999864


No 119
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=47.78  E-value=7.2  Score=19.78  Aligned_cols=15  Identities=27%  Similarity=0.758  Sum_probs=9.9

Q ss_pred             Cceeccccccccccc
Q 041414           74 KTHECSVCGLEFAIG   88 (152)
Q Consensus        74 k~~~C~~C~k~F~~~   88 (152)
                      -|+.|..|++.|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            489999999999753


No 120
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=47.57  E-value=8.5  Score=24.87  Aligned_cols=15  Identities=40%  Similarity=0.957  Sum_probs=12.2

Q ss_pred             ceeccccccccccch
Q 041414           75 THECSVCGLEFAIGQ   89 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~   89 (152)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999998655


No 121
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=47.55  E-value=9.4  Score=20.20  Aligned_cols=18  Identities=39%  Similarity=0.732  Sum_probs=14.4

Q ss_pred             CCceeccccccccccchH
Q 041414           73 PKTHECSVCGLEFAIGQA   90 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~   90 (152)
                      .+++.|..||..|.....
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            467899999999886544


No 122
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=46.66  E-value=13  Score=18.06  Aligned_cols=11  Identities=27%  Similarity=0.902  Sum_probs=5.5

Q ss_pred             ceecCcccccC
Q 041414           28 AFECKTCNRQF   38 (152)
Q Consensus        28 ~~~C~~C~k~f   38 (152)
                      ...|+.|+..|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            44555555444


No 123
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=46.25  E-value=10  Score=19.07  Aligned_cols=12  Identities=17%  Similarity=0.689  Sum_probs=10.3

Q ss_pred             cceecCcccccC
Q 041414           27 RAFECKTCNRQF   38 (152)
Q Consensus        27 ~~~~C~~C~k~f   38 (152)
                      ++-.|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            578999999876


No 124
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=45.40  E-value=8.2  Score=20.58  Aligned_cols=12  Identities=25%  Similarity=0.675  Sum_probs=6.8

Q ss_pred             eccccccccccc
Q 041414           77 ECSVCGLEFAIG   88 (152)
Q Consensus        77 ~C~~C~k~F~~~   88 (152)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999999864


No 125
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=44.51  E-value=16  Score=23.61  Aligned_cols=16  Identities=25%  Similarity=0.742  Sum_probs=12.8

Q ss_pred             CCceeccccccccccc
Q 041414           73 PKTHECSVCGLEFAIG   88 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~   88 (152)
                      ...|.|+.|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4569999999999753


No 126
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=44.25  E-value=2.9  Score=21.15  Aligned_cols=21  Identities=19%  Similarity=0.194  Sum_probs=10.4

Q ss_pred             chhcccCCCCCCCcccccccc
Q 041414            3 NCLMFMPHGGDFDAVNGVNMA   23 (152)
Q Consensus         3 ~C~~~~~~~~~~~~~~h~~~h   23 (152)
                      .|||.+.....-+...|.+.|
T Consensus        18 ~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   18 TCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCEECCCCHHHHHHHHHHH
Confidence            466666555444433444433


No 127
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=42.34  E-value=8.9  Score=32.18  Aligned_cols=48  Identities=21%  Similarity=0.352  Sum_probs=23.9

Q ss_pred             ecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccc
Q 041414           30 ECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLE   84 (152)
Q Consensus        30 ~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~   84 (152)
                      .|..||..+....- ..-+..|.......|..|+.      ....|..|+.||-.
T Consensus       437 ~C~~Cg~v~~Cp~C-d~~lt~H~~~~~L~CH~Cg~------~~~~p~~Cp~Cgs~  484 (730)
T COG1198         437 LCRDCGYIAECPNC-DSPLTLHKATGQLRCHYCGY------QEPIPQSCPECGSE  484 (730)
T ss_pred             ecccCCCcccCCCC-CcceEEecCCCeeEeCCCCC------CCCCCCCCCCCCCC
Confidence            46666655543210 11122333334445555543      23568889888854


No 128
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=42.21  E-value=8.7  Score=23.14  Aligned_cols=14  Identities=50%  Similarity=0.985  Sum_probs=11.6

Q ss_pred             ceeccccccccccc
Q 041414           75 THECSVCGLEFAIG   88 (152)
Q Consensus        75 ~~~C~~C~k~F~~~   88 (152)
                      .|.|..|++.|.-.
T Consensus        54 IW~C~~C~~~~AGG   67 (90)
T PRK03976         54 IWECRKCGAKFAGG   67 (90)
T ss_pred             EEEcCCCCCEEeCC
Confidence            69999999998743


No 129
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=41.85  E-value=18  Score=29.39  Aligned_cols=28  Identities=25%  Similarity=0.500  Sum_probs=23.1

Q ss_pred             CCcceecCcccccCCChhHHHHHHHhcC
Q 041414           25 ADRAFECKTCNRQFPSFQALGGHRASHK   52 (152)
Q Consensus        25 ~e~~~~C~~C~k~f~~~~~L~~h~~~h~   52 (152)
                      ...|..|..||..|........||..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3567899999999999888887777664


No 130
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=41.20  E-value=15  Score=23.09  Aligned_cols=15  Identities=13%  Similarity=0.226  Sum_probs=9.8

Q ss_pred             CcceecCcccccCCC
Q 041414           26 DRAFECKTCNRQFPS   40 (152)
Q Consensus        26 e~~~~C~~C~k~f~~   40 (152)
                      .-...|..||..|..
T Consensus        68 p~~~~C~~Cg~~~~~   82 (113)
T PRK12380         68 PAQAWCWDCSQVVEI   82 (113)
T ss_pred             CcEEEcccCCCEEec
Confidence            345678888876643


No 131
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=40.83  E-value=9  Score=17.70  Aligned_cols=19  Identities=21%  Similarity=0.497  Sum_probs=11.6

Q ss_pred             eeccccccccccchHHHHHH
Q 041414           76 HECSVCGLEFAIGQALGGHM   95 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~L~~H~   95 (152)
                      |.|-.|++.|.. ...+.|.
T Consensus         1 ~sCiDC~~~F~~-~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDFDG-DSYKSHT   19 (28)
T ss_dssp             EEETTTTEEEEG-GGTTT--
T ss_pred             CeeecCCCCcCc-CCcCCCC
Confidence            578889999953 3344454


No 132
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=39.78  E-value=24  Score=17.46  Aligned_cols=11  Identities=27%  Similarity=0.706  Sum_probs=8.4

Q ss_pred             ceecccccccc
Q 041414           75 THECSVCGLEF   85 (152)
Q Consensus        75 ~~~C~~C~k~F   85 (152)
                      -|.|..||..|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            38888888765


No 133
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=39.58  E-value=20  Score=22.87  Aligned_cols=24  Identities=33%  Similarity=0.539  Sum_probs=21.2

Q ss_pred             cceecCcccccCCChhHHHHHHHh
Q 041414           27 RAFECKTCNRQFPSFQALGGHRAS   50 (152)
Q Consensus        27 ~~~~C~~C~k~f~~~~~L~~h~~~   50 (152)
                      -.|-|-.|.+-|.....|..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            458999999999999999999764


No 134
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=39.41  E-value=19  Score=29.22  Aligned_cols=29  Identities=28%  Similarity=0.536  Sum_probs=24.0

Q ss_pred             CCceeccccccccccchHHHHHHhhccCC
Q 041414           73 PKTHECSVCGLEFAIGQALGGHMRRHRAG  101 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H~~~h~~~  101 (152)
                      ..|-.|..||..|........||..|...
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~dw  444 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDDW  444 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhhh
Confidence            46789999999999998888888777543


No 135
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=38.94  E-value=16  Score=20.33  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=5.1

Q ss_pred             ceecCcccccCC
Q 041414           28 AFECKTCNRQFP   39 (152)
Q Consensus        28 ~~~C~~C~k~f~   39 (152)
                      .-.|..|++.|.
T Consensus         9 ~~~C~~C~~~F~   20 (69)
T PF01363_consen    9 ASNCMICGKKFS   20 (69)
T ss_dssp             -SB-TTT--B-B
T ss_pred             CCcCcCcCCcCC
Confidence            346888888884


No 136
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=38.75  E-value=18  Score=22.79  Aligned_cols=19  Identities=16%  Similarity=0.489  Sum_probs=12.1

Q ss_pred             ccCCCcceecCcccccCCC
Q 041414           22 MAVADRAFECKTCNRQFPS   40 (152)
Q Consensus        22 ~h~~e~~~~C~~C~k~f~~   40 (152)
                      +..-.-...|..|+..|..
T Consensus        64 I~~~p~~~~C~~Cg~~~~~   82 (115)
T TIGR00100        64 IEDEPVECECEDCSEEVSP   82 (115)
T ss_pred             EEeeCcEEEcccCCCEEec
Confidence            3334445788888877654


No 137
>PRK14873 primosome assembly protein PriA; Provisional
Probab=38.40  E-value=26  Score=29.22  Aligned_cols=47  Identities=15%  Similarity=0.277  Sum_probs=25.8

Q ss_pred             ecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccc
Q 041414           30 ECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLE   84 (152)
Q Consensus        30 ~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~   84 (152)
                      .|..||..+.... -...+..|.......|..|+..       ..|+.|+.||..
T Consensus       385 ~C~~Cg~~~~C~~-C~~~L~~h~~~~~l~Ch~CG~~-------~~p~~Cp~Cgs~  431 (665)
T PRK14873        385 ACARCRTPARCRH-CTGPLGLPSAGGTPRCRWCGRA-------APDWRCPRCGSD  431 (665)
T ss_pred             EhhhCcCeeECCC-CCCceeEecCCCeeECCCCcCC-------CcCccCCCCcCC
Confidence            5666665554321 1112233444455667777642       248899999854


No 138
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=38.19  E-value=70  Score=24.27  Aligned_cols=69  Identities=14%  Similarity=0.119  Sum_probs=41.9

Q ss_pred             cceecCcccccCCChhHHHHHHHhcCCCCCCC------------CCCCCcccccccCCCCceeccccccccccchHHHHH
Q 041414           27 RAFECKTCNRQFPSFQALGGHRASHKKSRVTE------------GSGGGVDTQQSPVKPKTHECSVCGLEFAIGQALGGH   94 (152)
Q Consensus        27 ~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~------------c~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H   94 (152)
                      -|-+|++|+-.+....+|.+--+.--.-++|.            |..|...    -.+.-.|.|..|...|-...+.-.|
T Consensus       289 LP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~----~~~~~~y~C~~Ck~~FCldCDv~iH  364 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGE----LLSSGRYRCESCKNVFCLDCDVFIH  364 (378)
T ss_pred             CCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccc----cCCCCcEEchhccceeeccchHHHH
Confidence            46788999999888888875332111112221            2222110    0123359999999999888777777


Q ss_pred             Hhhcc
Q 041414           95 MRRHR   99 (152)
Q Consensus        95 ~~~h~   99 (152)
                      -..|.
T Consensus       365 esLh~  369 (378)
T KOG2807|consen  365 ESLHN  369 (378)
T ss_pred             hhhhc
Confidence            76664


No 139
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=37.96  E-value=30  Score=26.35  Aligned_cols=29  Identities=31%  Similarity=0.470  Sum_probs=24.0

Q ss_pred             ceeccccccccccchHHHHHHhh--ccCCCc
Q 041414           75 THECSVCGLEFAIGQALGGHMRR--HRAGAS  103 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~--h~~~~~  103 (152)
                      .+.|-.|.+.|..+..|+.||+.  |..-.|
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinP  225 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINP  225 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCC
Confidence            58999999999999999999974  544444


No 140
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=37.78  E-value=23  Score=28.10  Aligned_cols=28  Identities=29%  Similarity=0.493  Sum_probs=24.0

Q ss_pred             ceeccccccccccchHHHHHHh-hccCCC
Q 041414           75 THECSVCGLEFAIGQALGGHMR-RHRAGA  102 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~-~h~~~~  102 (152)
                      -+.|+.|.+.|.....+..|+. .|.+.-
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~l   85 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAGL   85 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhhc
Confidence            5789999999999999999997 476653


No 141
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=37.65  E-value=27  Score=19.40  Aligned_cols=15  Identities=27%  Similarity=0.738  Sum_probs=11.5

Q ss_pred             CCceecccccccccc
Q 041414           73 PKTHECSVCGLEFAI   87 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~   87 (152)
                      .+.|.|+.||..+..
T Consensus        44 ~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   44 GRVFTCPNCGFEMDR   58 (69)
T ss_pred             cceEEcCCCCCEECc
Confidence            567999999977654


No 142
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=36.74  E-value=21  Score=22.59  Aligned_cols=19  Identities=26%  Similarity=0.646  Sum_probs=12.3

Q ss_pred             ccCCCcceecCcccccCCC
Q 041414           22 MAVADRAFECKTCNRQFPS   40 (152)
Q Consensus        22 ~h~~e~~~~C~~C~k~f~~   40 (152)
                      +..-.-.+.|..||..|..
T Consensus        65 Ie~vp~~~~C~~Cg~~~~~   83 (117)
T PRK00564         65 IVDEKVELECKDCSHVFKP   83 (117)
T ss_pred             EEecCCEEEhhhCCCcccc
Confidence            3334455788888877654


No 143
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=35.95  E-value=20  Score=22.16  Aligned_cols=16  Identities=38%  Similarity=0.872  Sum_probs=12.7

Q ss_pred             ceeccccccccccchH
Q 041414           75 THECSVCGLEFAIGQA   90 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~   90 (152)
                      |+.|..||..|...+.
T Consensus         2 pH~CtrCG~vf~~g~~   17 (112)
T COG3364           2 PHQCTRCGEVFDDGSE   17 (112)
T ss_pred             CceecccccccccccH
Confidence            6789999999987543


No 144
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=35.62  E-value=16  Score=18.66  Aligned_cols=15  Identities=33%  Similarity=0.767  Sum_probs=11.5

Q ss_pred             eeccccccccccchH
Q 041414           76 HECSVCGLEFAIGQA   90 (152)
Q Consensus        76 ~~C~~C~k~F~~~~~   90 (152)
                      -.|..||+.|.....
T Consensus         9 K~C~~C~rpf~WRKK   23 (42)
T PF10013_consen    9 KICPVCGRPFTWRKK   23 (42)
T ss_pred             CcCcccCCcchHHHH
Confidence            359999999986543


No 145
>KOG2636 consensus Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=35.38  E-value=26  Score=27.61  Aligned_cols=29  Identities=17%  Similarity=0.367  Sum_probs=24.4

Q ss_pred             cccCCCCceeccccc-cccccchHHHHHHh
Q 041414           68 QSPVKPKTHECSVCG-LEFAIGQALGGHMR   96 (152)
Q Consensus        68 ~~h~~~k~~~C~~C~-k~F~~~~~L~~H~~   96 (152)
                      +.|.-.+.|.|.+|| .++.-...+.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            556777889999999 88888889999964


No 146
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=35.36  E-value=45  Score=24.21  Aligned_cols=59  Identities=17%  Similarity=0.296  Sum_probs=29.9

Q ss_pred             ccCCCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccc----cCCCCceeccccccccccc
Q 041414           22 MAVADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQS----PVKPKTHECSVCGLEFAIG   88 (152)
Q Consensus        22 ~h~~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~----h~~~k~~~C~~C~k~F~~~   88 (152)
                      |-+..+.|.|..|...+=        .++-.....-+|..|....--+    =-|---|.|+.|+..|...
T Consensus       106 ip~~drqFaC~~Cd~~Ww--------Rrvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  106 IPSVDRQFACSSCDHMWW--------RRVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             ccccceeeeccccchHHH--------hccCcccccccccccccccCCCccccccceeeeecccccccchhh
Confidence            344557788888864321        1222222233455554411100    0122348888888888754


No 147
>COG1773 Rubredoxin [Energy production and conversion]
Probab=35.23  E-value=18  Score=19.66  Aligned_cols=15  Identities=40%  Similarity=0.829  Sum_probs=11.6

Q ss_pred             Cceeccccccccccc
Q 041414           74 KTHECSVCGLEFAIG   88 (152)
Q Consensus        74 k~~~C~~C~k~F~~~   88 (152)
                      +.|+|..||..|.-.
T Consensus         2 ~~~~C~~CG~vYd~e   16 (55)
T COG1773           2 KRWRCSVCGYVYDPE   16 (55)
T ss_pred             CceEecCCceEeccc
Confidence            358999999888653


No 148
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=34.15  E-value=41  Score=17.17  Aligned_cols=11  Identities=18%  Similarity=0.489  Sum_probs=7.2

Q ss_pred             CCceecccccc
Q 041414           73 PKTHECSVCGL   83 (152)
Q Consensus        73 ~k~~~C~~C~k   83 (152)
                      ...|+|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            45677777764


No 149
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=33.53  E-value=22  Score=27.96  Aligned_cols=28  Identities=25%  Similarity=0.438  Sum_probs=24.3

Q ss_pred             CceeccccccccccchHHHHHHhh-ccCC
Q 041414           74 KTHECSVCGLEFAIGQALGGHMRR-HRAG  101 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H~~~-h~~~  101 (152)
                      ..|.|++|.+-|.....|..|... |.++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            469999999999999999999975 5554


No 150
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=33.49  E-value=24  Score=22.19  Aligned_cols=16  Identities=19%  Similarity=0.466  Sum_probs=10.1

Q ss_pred             CCCcceecCcccccCC
Q 041414           24 VADRAFECKTCNRQFP   39 (152)
Q Consensus        24 ~~e~~~~C~~C~k~f~   39 (152)
                      .-.-...|..||..|.
T Consensus        66 ~~p~~~~C~~Cg~~~~   81 (114)
T PRK03681         66 EQEAECWCETCQQYVT   81 (114)
T ss_pred             eeCcEEEcccCCCeee
Confidence            3344577888887654


No 151
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=33.22  E-value=29  Score=18.35  Aligned_cols=11  Identities=27%  Similarity=0.866  Sum_probs=7.2

Q ss_pred             ecCcccccCCC
Q 041414           30 ECKTCNRQFPS   40 (152)
Q Consensus        30 ~C~~C~k~f~~   40 (152)
                      .|..|++.|..
T Consensus         4 ~C~~C~~~F~~   14 (57)
T cd00065           4 SCMGCGKPFTL   14 (57)
T ss_pred             cCcccCccccC
Confidence            46677777753


No 152
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=33.13  E-value=30  Score=27.09  Aligned_cols=21  Identities=19%  Similarity=0.649  Sum_probs=15.2

Q ss_pred             cCCCcceecCcccccCCChhH
Q 041414           23 AVADRAFECKTCNRQFPSFQA   43 (152)
Q Consensus        23 h~~e~~~~C~~C~k~f~~~~~   43 (152)
                      -+...-|.|+.|.+.|..-..
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEA  143 (436)
T ss_pred             ccccccccCCccccchhhhHH
Confidence            345567999999999965443


No 153
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=32.87  E-value=20  Score=23.44  Aligned_cols=20  Identities=25%  Similarity=0.486  Sum_probs=15.1

Q ss_pred             cccCCCCceeccccccccccc
Q 041414           68 QSPVKPKTHECSVCGLEFAIG   88 (152)
Q Consensus        68 ~~h~~~k~~~C~~C~k~F~~~   88 (152)
                      ..+.+ ++..|++||..|.-.
T Consensus       106 ~l~~g-~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  106 WLHKG-KPQRCPECGQVFKLK  125 (136)
T ss_dssp             EEETT-SEEEETTTEEEEEEE
T ss_pred             EEeCC-CccCCCCCCeEEEEE
Confidence            34555 589999999999753


No 154
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=32.74  E-value=13  Score=29.72  Aligned_cols=47  Identities=21%  Similarity=0.352  Sum_probs=22.4

Q ss_pred             ecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceecccccc
Q 041414           30 ECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGL   83 (152)
Q Consensus        30 ~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k   83 (152)
                      .|..||....... -...+..|.......|..|+..      ...|..|+.||.
T Consensus       215 ~C~~Cg~~~~C~~-C~~~l~~h~~~~~l~Ch~Cg~~------~~~~~~Cp~C~s  261 (505)
T TIGR00595       215 LCRSCGYILCCPN-CDVSLTYHKKEGKLRCHYCGYQ------EPIPKTCPQCGS  261 (505)
T ss_pred             EhhhCcCccCCCC-CCCceEEecCCCeEEcCCCcCc------CCCCCCCCCCCC
Confidence            4555555544321 1112233334444455555432      245778888875


No 155
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=32.40  E-value=50  Score=16.42  Aligned_cols=12  Identities=25%  Similarity=0.683  Sum_probs=8.8

Q ss_pred             ceeccccccccc
Q 041414           75 THECSVCGLEFA   86 (152)
Q Consensus        75 ~~~C~~C~k~F~   86 (152)
                      -|.|..||..|.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            488888887654


No 156
>PHA02998 RNA polymerase subunit; Provisional
Probab=31.39  E-value=39  Score=23.17  Aligned_cols=12  Identities=33%  Similarity=0.753  Sum_probs=8.9

Q ss_pred             eecccccccccc
Q 041414           76 HECSVCGLEFAI   87 (152)
Q Consensus        76 ~~C~~C~k~F~~   87 (152)
                      |.|..||..|..
T Consensus       172 YkC~~CG~~wkp  183 (195)
T PHA02998        172 HACRDCKKHFKP  183 (195)
T ss_pred             EEcCCCCCccCC
Confidence            778888877654


No 157
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=31.05  E-value=32  Score=17.25  Aligned_cols=11  Identities=36%  Similarity=0.848  Sum_probs=6.5

Q ss_pred             ceecccccccc
Q 041414           75 THECSVCGLEF   85 (152)
Q Consensus        75 ~~~C~~C~k~F   85 (152)
                      -+.|..||...
T Consensus        19 ~~vC~~CG~Vl   29 (43)
T PF08271_consen   19 ELVCPNCGLVL   29 (43)
T ss_dssp             EEEETTT-BBE
T ss_pred             eEECCCCCCEe
Confidence            46777777554


No 158
>PTZ00448 hypothetical protein; Provisional
Probab=31.02  E-value=32  Score=26.44  Aligned_cols=25  Identities=20%  Similarity=0.387  Sum_probs=21.7

Q ss_pred             ceeccccccccccchHHHHHHhhcc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~   99 (152)
                      .|.|..|+-.|......+.|+++-.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSDw  338 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSEW  338 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhhH
Confidence            5889999999998888899998743


No 159
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=30.77  E-value=32  Score=26.16  Aligned_cols=23  Identities=22%  Similarity=0.479  Sum_probs=21.0

Q ss_pred             ceecCcccccCCChhHHHHHHHh
Q 041414           28 AFECKTCNRQFPSFQALGGHRAS   50 (152)
Q Consensus        28 ~~~C~~C~k~f~~~~~L~~h~~~   50 (152)
                      .+.|-.|.+.|+.+..|+.||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999985


No 160
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=30.12  E-value=17  Score=25.28  Aligned_cols=29  Identities=17%  Similarity=0.373  Sum_probs=0.0

Q ss_pred             cccCCCCceeccccc-cccccchHHHHHHh
Q 041414           68 QSPVKPKTHECSVCG-LEFAIGQALGGHMR   96 (152)
Q Consensus        68 ~~h~~~k~~~C~~C~-k~F~~~~~L~~H~~   96 (152)
                      +.|--.+.|.|.+|| .+|.-...+.+|..
T Consensus        94 KLhGL~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   94 KLHGLGVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             ------------------------------
T ss_pred             HHhCCCCeeeeEeCCCcceecHHHHHHhcC
Confidence            445556789999999 46667777777753


No 161
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=30.06  E-value=22  Score=19.23  Aligned_cols=31  Identities=19%  Similarity=0.353  Sum_probs=18.1

Q ss_pred             ceeccccccccccchHHHHHHhhccCCCcccccccccc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHRAGASHANEKLSAF  112 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~~~~~~~~  112 (152)
                      .|+|+.||..+.-...       ..|+...++.|+..+
T Consensus         2 ~~~CP~CG~~iev~~~-------~~GeiV~Cp~CGael   32 (54)
T TIGR01206         2 QFECPDCGAEIELENP-------ELGELVICDECGAEL   32 (54)
T ss_pred             ccCCCCCCCEEecCCC-------ccCCEEeCCCCCCEE
Confidence            3789999987753322       124544456666443


No 162
>PF14353 CpXC:  CpXC protein
Probab=29.21  E-value=25  Score=22.36  Aligned_cols=22  Identities=27%  Similarity=0.484  Sum_probs=16.2

Q ss_pred             CceeccccccccccchHHHHHH
Q 041414           74 KTHECSVCGLEFAIGQALGGHM   95 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H~   95 (152)
                      -.|.|+.||..|.-...+..|-
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D   58 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHD   58 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEc
Confidence            3699999999998665554443


No 163
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=29.05  E-value=27  Score=24.88  Aligned_cols=15  Identities=20%  Similarity=0.410  Sum_probs=13.0

Q ss_pred             CCceecccccccccc
Q 041414           73 PKTHECSVCGLEFAI   87 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~   87 (152)
                      .++.+|.+||..|.-
T Consensus       179 GkpqRCpECGqVFKL  193 (268)
T PTZ00043        179 GFLYRCGECDQIFML  193 (268)
T ss_pred             CCCccCCCCCcEEEE
Confidence            468999999999985


No 164
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=28.94  E-value=28  Score=22.99  Aligned_cols=6  Identities=50%  Similarity=1.542  Sum_probs=3.2

Q ss_pred             eccccc
Q 041414           77 ECSVCG   82 (152)
Q Consensus        77 ~C~~C~   82 (152)
                      .|+.||
T Consensus       132 ~Cp~C~  137 (146)
T PF07295_consen  132 PCPKCG  137 (146)
T ss_pred             CCCCCC
Confidence            455555


No 165
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=28.68  E-value=32  Score=26.95  Aligned_cols=16  Identities=19%  Similarity=0.393  Sum_probs=12.3

Q ss_pred             Cceeccccccccccch
Q 041414           74 KTHECSVCGLEFAIGQ   89 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~   89 (152)
                      .-|+|+.||..+....
T Consensus       366 ~g~rC~kCg~~~~~~~  381 (421)
T COG1571         366 NGFRCKKCGTRARETL  381 (421)
T ss_pred             CCcccccccccCCccc
Confidence            3799999998877643


No 166
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=26.74  E-value=45  Score=26.39  Aligned_cols=11  Identities=18%  Similarity=0.393  Sum_probs=7.5

Q ss_pred             Cceeccccccc
Q 041414           74 KTHECSVCGLE   84 (152)
Q Consensus        74 k~~~C~~C~k~   84 (152)
                      ..++|+.|+.+
T Consensus        20 ~~g~Cp~C~~w   30 (454)
T TIGR00416        20 WQGKCPACHAW   30 (454)
T ss_pred             ccEECcCCCCc
Confidence            45788888743


No 167
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=26.54  E-value=74  Score=15.24  Aligned_cols=24  Identities=25%  Similarity=0.499  Sum_probs=15.5

Q ss_pred             ceeccccccccccchHHHHHHhhcc
Q 041414           75 THECSVCGLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        75 ~~~C~~C~k~F~~~~~L~~H~~~h~   99 (152)
                      .+.|+.|++.+.. +-+..|+..-.
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HLekCm   27 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHLEKCM   27 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHHHHHT
T ss_pred             eEECCCCcCCcch-hhhHHHHHHHH
Confidence            5789999998764 34566765433


No 168
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=26.08  E-value=31  Score=18.90  Aligned_cols=26  Identities=19%  Similarity=0.238  Sum_probs=16.2

Q ss_pred             cchhcccCCCCCCCccccccccCCCcceecCcccccC
Q 041414            2 ANCLMFMPHGGDFDAVNGVNMAVADRAFECKTCNRQF   38 (152)
Q Consensus         2 ~~C~~~~~~~~~~~~~~h~~~h~~e~~~~C~~C~k~f   38 (152)
                      |+||+.|...++-.           +--.|+.|.+-|
T Consensus        29 ALCGk~wvp~rdp~-----------~~PVCP~Ck~iy   54 (58)
T PF11238_consen   29 ALCGKVWVPTRDPK-----------PFPVCPECKEIY   54 (58)
T ss_pred             eeeCceeCCCCCCC-----------CCCCCcCHHHHH
Confidence            78998887665533           123577776544


No 169
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=26.03  E-value=18  Score=19.29  Aligned_cols=26  Identities=23%  Similarity=0.322  Sum_probs=13.3

Q ss_pred             CceeccccccccccchHHHHHHhhcc
Q 041414           74 KTHECSVCGLEFAIGQALGGHMRRHR   99 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H~~~h~   99 (152)
                      ..|+|+.|...|=..-.+-.|...|.
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CeEECCCCCCccccCcChhhhccccC
Confidence            46888888888876666655655553


No 170
>PRK11823 DNA repair protein RadA; Provisional
Probab=26.01  E-value=48  Score=26.18  Aligned_cols=12  Identities=25%  Similarity=0.791  Sum_probs=8.2

Q ss_pred             cceecCcccccC
Q 041414           27 RAFECKTCNRQF   38 (152)
Q Consensus        27 ~~~~C~~C~k~f   38 (152)
                      ..|.|..||..+
T Consensus         6 ~~y~C~~Cg~~~   17 (446)
T PRK11823          6 TAYVCQECGAES   17 (446)
T ss_pred             CeEECCcCCCCC
Confidence            357888887654


No 171
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=25.71  E-value=32  Score=16.33  Aligned_cols=11  Identities=36%  Similarity=0.779  Sum_probs=7.6

Q ss_pred             eeccccccccc
Q 041414           76 HECSVCGLEFA   86 (152)
Q Consensus        76 ~~C~~C~k~F~   86 (152)
                      |.|..||..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            56888887766


No 173
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=25.26  E-value=33  Score=16.82  Aligned_cols=12  Identities=17%  Similarity=0.755  Sum_probs=6.3

Q ss_pred             cceecCcccccC
Q 041414           27 RAFECKTCNRQF   38 (152)
Q Consensus        27 ~~~~C~~C~k~f   38 (152)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            458899888653


No 174
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=25.07  E-value=44  Score=24.87  Aligned_cols=59  Identities=19%  Similarity=0.270  Sum_probs=31.4

Q ss_pred             CcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCcccccccCCCCceeccccccc----cccchHHHHHHhh
Q 041414           26 DRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGVDTQQSPVKPKTHECSVCGLE----FAIGQALGGHMRR   97 (152)
Q Consensus        26 e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~~h~~~h~~~k~~~C~~C~k~----F~~~~~L~~H~~~   97 (152)
                      .-||.|.+|.+.|...-        -+.-..+-|..|...+.     .+.-+|.+|++.    |.....|..-+..
T Consensus       239 ~~Pf~c~icr~~f~~pV--------vt~c~h~fc~~ca~~~~-----qk~~~c~vC~~~t~g~~~~akeL~~~L~~  301 (313)
T KOG1813|consen  239 LLPFKCFICRKYFYRPV--------VTKCGHYFCEVCALKPY-----QKGEKCYVCSQQTHGSFNVAKELLVSLKL  301 (313)
T ss_pred             cCCccccccccccccch--------hhcCCceeehhhhcccc-----ccCCcceecccccccccchHHHHHHHHHh
Confidence            45899999999987542        12222333444433222     233467777753    4444455544443


No 175
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=25.06  E-value=30  Score=23.09  Aligned_cols=20  Identities=10%  Similarity=0.160  Sum_probs=9.0

Q ss_pred             chhcccCCCCCCCccccccc
Q 041414            3 NCLMFMPHGGDFDAVNGVNM   22 (152)
Q Consensus         3 ~C~~~~~~~~~~~~~~h~~~   22 (152)
                      .|+|.|.+++.-....|+..
T Consensus        19 ~c~kWFCNg~~~~s~SHIv~   38 (152)
T PF09416_consen   19 TCNKWFCNGRGNTSGSHIVN   38 (152)
T ss_dssp             TTTEEEES--TTSSS-HHHH
T ss_pred             CCCcEeecCCCCCcccHHHH
Confidence            35667766655443445433


No 176
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=24.82  E-value=31  Score=18.27  Aligned_cols=13  Identities=31%  Similarity=0.649  Sum_probs=10.9

Q ss_pred             CCceecccccccc
Q 041414           73 PKTHECSVCGLEF   85 (152)
Q Consensus        73 ~k~~~C~~C~k~F   85 (152)
                      ...|.|..||+.|
T Consensus         4 ~~~Y~C~~Cg~~~   16 (49)
T COG1996           4 MMEYKCARCGREV   16 (49)
T ss_pred             eEEEEhhhcCCee
Confidence            3469999999998


No 177
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=24.78  E-value=48  Score=26.38  Aligned_cols=21  Identities=33%  Similarity=0.678  Sum_probs=18.5

Q ss_pred             eecCcccccCCChhHHHHHHH
Q 041414           29 FECKTCNRQFPSFQALGGHRA   49 (152)
Q Consensus        29 ~~C~~C~k~f~~~~~L~~h~~   49 (152)
                      +-|.+|+|+|.+.-.|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999988888864


No 178
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=24.62  E-value=46  Score=25.47  Aligned_cols=29  Identities=17%  Similarity=0.361  Sum_probs=22.7

Q ss_pred             cccCCCCceeccccc-cccccchHHHHHHh
Q 041414           68 QSPVKPKTHECSVCG-LEFAIGQALGGHMR   96 (152)
Q Consensus        68 ~~h~~~k~~~C~~C~-k~F~~~~~L~~H~~   96 (152)
                      +.|.-.+-|.|.+|| +++.....+.+|..
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhhh
Confidence            346667889999999 78877777888863


No 179
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=24.45  E-value=32  Score=16.66  Aligned_cols=13  Identities=31%  Similarity=0.718  Sum_probs=6.6

Q ss_pred             eccccccccccch
Q 041414           77 ECSVCGLEFAIGQ   89 (152)
Q Consensus        77 ~C~~C~k~F~~~~   89 (152)
                      .|.+|++.|..+.
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            6888998887543


No 180
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=23.85  E-value=19  Score=30.15  Aligned_cols=51  Identities=16%  Similarity=0.255  Sum_probs=28.6

Q ss_pred             ecCcccccCCChhHHHHHHHhcCCCCCCC-CCCCCc-----ccccccCCCCceecccccc
Q 041414           30 ECKTCNRQFPSFQALGGHRASHKKSRVTE-GSGGGV-----DTQQSPVKPKTHECSVCGL   83 (152)
Q Consensus        30 ~C~~C~k~f~~~~~L~~h~~~h~~~~~~~-c~~~~~-----~h~~~h~~~k~~~C~~C~k   83 (152)
                      .|..||-.|+-...|... |-++.=+.|. |+.|.+     ...+-|.  .|..|+.||-
T Consensus       125 ~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfHA--Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFHA--QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCcccccccc--ccccCcccCC
Confidence            478888888766555433 2233333343 666654     2223343  3678999985


No 181
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=23.55  E-value=74  Score=26.63  Aligned_cols=72  Identities=18%  Similarity=0.215  Sum_probs=36.6

Q ss_pred             ecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc-----------ccccccCCCCceecc--ccc-cccccc----hHH
Q 041414           30 ECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV-----------DTQQSPVKPKTHECS--VCG-LEFAIG----QAL   91 (152)
Q Consensus        30 ~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~-----------~h~~~h~~~k~~~C~--~C~-k~F~~~----~~L   91 (152)
                      .|..|...|.....|.+|++.++-    .|..|.+           .-+..|-.+..|.|.  .|. +.|...    ..|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h~----~chfC~~~~~~neyy~~~~dLe~HfR~~HflCE~~~C~~~~f~~~~~~ei~l  259 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDHE----FCHFCDYKTGQNEYYNDYDDLEEHFRKGHFLCEEEFCRTKKFYVAFELEIEL  259 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcccee----heeecCcccccchhcccchHHHHHhhhcCccccccccccceeeehhHHHHHH
Confidence            466777777777777777664332    2222210           223445556678887  454 334433    444


Q ss_pred             HHHHhhccCCCccc
Q 041414           92 GGHMRRHRAGASHA  105 (152)
Q Consensus        92 ~~H~~~h~~~~~~~  105 (152)
                      ++|.+.+..++.|.
T Consensus       260 k~~~~~~~~e~~~~  273 (669)
T KOG2231|consen  260 KAHNRFIQHEKCYI  273 (669)
T ss_pred             Hhhccccchheecc
Confidence            44443333343333


No 182
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=23.43  E-value=86  Score=16.08  Aligned_cols=12  Identities=33%  Similarity=0.708  Sum_probs=8.7

Q ss_pred             ceeccccccccc
Q 041414           75 THECSVCGLEFA   86 (152)
Q Consensus        75 ~~~C~~C~k~F~   86 (152)
                      .|.|+.||..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            578888886544


No 183
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=22.95  E-value=36  Score=16.58  Aligned_cols=12  Identities=33%  Similarity=0.822  Sum_probs=8.6

Q ss_pred             eecccccccccc
Q 041414           76 HECSVCGLEFAI   87 (152)
Q Consensus        76 ~~C~~C~k~F~~   87 (152)
                      +.|+.||+.|.-
T Consensus         2 r~C~~Cg~~Yh~   13 (36)
T PF05191_consen    2 RICPKCGRIYHI   13 (36)
T ss_dssp             EEETTTTEEEET
T ss_pred             cCcCCCCCcccc
Confidence            468888888763


No 184
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=22.27  E-value=43  Score=20.85  Aligned_cols=24  Identities=29%  Similarity=0.425  Sum_probs=20.7

Q ss_pred             CCceeccccccccccchHHHHHHh
Q 041414           73 PKTHECSVCGLEFAIGQALGGHMR   96 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H~~   96 (152)
                      .-.|-|.+|.+-|-+...|..|.+
T Consensus        53 lGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          53 LGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CceeeeehhHHHHHHHHHHHHHhc
Confidence            345889999999999999999976


No 185
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=22.17  E-value=48  Score=20.72  Aligned_cols=15  Identities=20%  Similarity=0.403  Sum_probs=11.6

Q ss_pred             Cceeccccccccccc
Q 041414           74 KTHECSVCGLEFAIG   88 (152)
Q Consensus        74 k~~~C~~C~k~F~~~   88 (152)
                      ..|.|++|+..+...
T Consensus        18 ~~~iCpeC~~EW~~~   32 (109)
T TIGR00686        18 TQLICPSCLYEWNEN   32 (109)
T ss_pred             CeeECcccccccccc
Confidence            369999999777654


No 186
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=21.87  E-value=56  Score=21.17  Aligned_cols=20  Identities=10%  Similarity=0.539  Sum_probs=14.4

Q ss_pred             ccCCCcceecCcccccCCCh
Q 041414           22 MAVADRAFECKTCNRQFPSF   41 (152)
Q Consensus        22 ~h~~e~~~~C~~C~k~f~~~   41 (152)
                      +-.....+.|..||..|...
T Consensus        64 i~~~p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         64 FEEEEAVLKCRNCGNEWSLK   83 (135)
T ss_pred             EEecceEEECCCCCCEEecc
Confidence            33445678999999888654


No 187
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=21.76  E-value=43  Score=17.48  Aligned_cols=13  Identities=31%  Similarity=0.830  Sum_probs=9.8

Q ss_pred             eeccccccccccc
Q 041414           76 HECSVCGLEFAIG   88 (152)
Q Consensus        76 ~~C~~C~k~F~~~   88 (152)
                      |.|..||..+...
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            7888898777654


No 188
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=21.70  E-value=38  Score=16.61  Aligned_cols=14  Identities=29%  Similarity=0.653  Sum_probs=8.6

Q ss_pred             eccccccccccchH
Q 041414           77 ECSVCGLEFAIGQA   90 (152)
Q Consensus        77 ~C~~C~k~F~~~~~   90 (152)
                      .|+.|++.|-..+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            57888888776554


No 189
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=21.41  E-value=47  Score=15.83  Aligned_cols=12  Identities=33%  Similarity=0.830  Sum_probs=9.4

Q ss_pred             ceeccccccccc
Q 041414           75 THECSVCGLEFA   86 (152)
Q Consensus        75 ~~~C~~C~k~F~   86 (152)
                      -+.|..||.+|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            467999998875


No 190
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=21.32  E-value=38  Score=17.91  Aligned_cols=13  Identities=31%  Similarity=0.869  Sum_probs=10.0

Q ss_pred             eeccccccccccc
Q 041414           76 HECSVCGLEFAIG   88 (152)
Q Consensus        76 ~~C~~C~k~F~~~   88 (152)
                      |.|..||..+...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            7899999877643


No 191
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=21.30  E-value=43  Score=22.32  Aligned_cols=10  Identities=30%  Similarity=0.776  Sum_probs=7.1

Q ss_pred             ceeccccccc
Q 041414           75 THECSVCGLE   84 (152)
Q Consensus        75 ~~~C~~C~k~   84 (152)
                      .|.|..|+-.
T Consensus       140 ~YrC~~C~gk  149 (156)
T COG3091         140 VYRCGKCGGK  149 (156)
T ss_pred             eEEeccCCce
Confidence            6888887643


No 192
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=21.13  E-value=42  Score=24.28  Aligned_cols=31  Identities=13%  Similarity=0.184  Sum_probs=11.6

Q ss_pred             CCCCCCcccccccC---CCCceeccccccccccc
Q 041414           58 EGSGGGVDTQQSPV---KPKTHECSVCGLEFAIG   88 (152)
Q Consensus        58 ~c~~~~~~h~~~h~---~~k~~~C~~C~k~F~~~   88 (152)
                      .|+.|+..++....   ....|-|+.|+..|--+
T Consensus        33 yCP~Cg~~~L~~f~NN~PVaDF~C~~C~eeyELK   66 (254)
T PF06044_consen   33 YCPNCGSKPLSKFENNRPVADFYCPNCNEEYELK   66 (254)
T ss_dssp             --TTT--SS-EE--------EEE-TTT--EEEEE
T ss_pred             cCCCCCChhHhhccCCCccceeECCCCchHHhhh
Confidence            36666654333322   23459999998887643


No 193
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=20.88  E-value=31  Score=28.90  Aligned_cols=22  Identities=18%  Similarity=0.489  Sum_probs=16.1

Q ss_pred             CCceeccccccccccchHHHHH
Q 041414           73 PKTHECSVCGLEFAIGQALGGH   94 (152)
Q Consensus        73 ~k~~~C~~C~k~F~~~~~L~~H   94 (152)
                      -+.-+||.|+.+|....-+..|
T Consensus       676 tRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  676 TRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             HhcCCCCCCCCCCCcccccccC
Confidence            3567899999999876654433


No 194
>PLN02748 tRNA dimethylallyltransferase
Probab=20.83  E-value=62  Score=25.83  Aligned_cols=24  Identities=17%  Similarity=0.310  Sum_probs=20.7

Q ss_pred             Cceecccccc-ccccchHHHHHHhh
Q 041414           74 KTHECSVCGL-EFAIGQALGGHMRR   97 (152)
Q Consensus        74 k~~~C~~C~k-~F~~~~~L~~H~~~   97 (152)
                      +.|.|..|++ .+........|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            6789999997 89999889999864


No 195
>PF14369 zf-RING_3:  zinc-finger
Probab=20.73  E-value=65  Score=15.55  Aligned_cols=10  Identities=30%  Similarity=0.886  Sum_probs=7.4

Q ss_pred             ecCcccccCC
Q 041414           30 ECKTCNRQFP   39 (152)
Q Consensus        30 ~C~~C~k~f~   39 (152)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4888887774


No 196
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=20.70  E-value=65  Score=24.82  Aligned_cols=11  Identities=27%  Similarity=0.486  Sum_probs=7.4

Q ss_pred             Cceeccccccc
Q 041414           74 KTHECSVCGLE   84 (152)
Q Consensus        74 k~~~C~~C~k~   84 (152)
                      +..+|+.|+.+
T Consensus        13 ~~g~cp~c~~w   23 (372)
T cd01121          13 WLGKCPECGEW   23 (372)
T ss_pred             ccEECcCCCCc
Confidence            45778888753


No 197
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=20.66  E-value=47  Score=17.72  Aligned_cols=18  Identities=17%  Similarity=0.346  Sum_probs=11.9

Q ss_pred             CCCCceeccccccccccc
Q 041414           71 VKPKTHECSVCGLEFAIG   88 (152)
Q Consensus        71 ~~~k~~~C~~C~k~F~~~   88 (152)
                      .....|+|.+|++.|...
T Consensus        31 ~~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   31 KEPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTTCEEEETTT--EEEHH
T ss_pred             CCCCEEEeeCCCCEeccc
Confidence            445679999999987643


No 198
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=20.43  E-value=51  Score=24.77  Aligned_cols=50  Identities=12%  Similarity=0.086  Sum_probs=27.9

Q ss_pred             CCcceecCcccccCCChhHHHHHHHhcCCCCCCCCCCCCc-ccccccCCCCceecccccc
Q 041414           25 ADRAFECKTCNRQFPSFQALGGHRASHKKSRVTEGSGGGV-DTQQSPVKPKTHECSVCGL   83 (152)
Q Consensus        25 ~e~~~~C~~C~k~f~~~~~L~~h~~~h~~~~~~~c~~~~~-~h~~~h~~~k~~~C~~C~k   83 (152)
                      ++..-.|++||..=. .+ +. +.....|.+-..|..|.. .|.      ..-+|+.||.
T Consensus       184 ~~~~~~CPvCGs~P~-~s-~v-~~~~~~G~RyL~CslC~teW~~------~R~~C~~Cg~  234 (309)
T PRK03564        184 GEQRQFCPVCGSMPV-SS-VV-QIGTTQGLRYLHCNLCESEWHV------VRVKCSNCEQ  234 (309)
T ss_pred             ccCCCCCCCCCCcch-hh-ee-eccCCCCceEEEcCCCCCcccc------cCccCCCCCC
Confidence            345568999996521 11 11 222345556566777765 221      2357888885


No 199
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=20.33  E-value=62  Score=22.08  Aligned_cols=21  Identities=24%  Similarity=0.407  Sum_probs=16.3

Q ss_pred             CceeccccccccccchHHHHH
Q 041414           74 KTHECSVCGLEFAIGQALGGH   94 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H   94 (152)
                      ....|..||+.|.....+..=
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~~~  133 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVALA  133 (181)
T ss_pred             ccCcCcccCCccCcHhHHHHH
Confidence            578899999999977665543


No 200
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=20.24  E-value=68  Score=21.71  Aligned_cols=23  Identities=17%  Similarity=0.351  Sum_probs=17.8

Q ss_pred             CceeccccccccccchHHHHHHh
Q 041414           74 KTHECSVCGLEFAIGQALGGHMR   96 (152)
Q Consensus        74 k~~~C~~C~k~F~~~~~L~~H~~   96 (152)
                      .-|.|+.||+.|...++..+-.+
T Consensus       129 ~f~~C~~CgkiYW~GsHw~~m~~  151 (165)
T COG1656         129 EFYRCPKCGKIYWKGSHWRRMVE  151 (165)
T ss_pred             ceeECCCCcccccCchHHHHHHH
Confidence            45789999999998887764433


No 201
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=20.17  E-value=83  Score=27.10  Aligned_cols=13  Identities=31%  Similarity=0.703  Sum_probs=10.6

Q ss_pred             eeccccccccccc
Q 041414           76 HECSVCGLEFAIG   88 (152)
Q Consensus        76 ~~C~~C~k~F~~~   88 (152)
                      -.|..|++.|...
T Consensus       461 dtC~~C~kkFfSl  473 (1374)
T PTZ00303        461 DSCPSCGRAFISL  473 (1374)
T ss_pred             CcccCcCCccccc
Confidence            4599999999754


No 202
>PRK04023 DNA polymerase II large subunit; Validated
Probab=20.11  E-value=84  Score=27.76  Aligned_cols=10  Identities=20%  Similarity=0.869  Sum_probs=7.3

Q ss_pred             ceecCccccc
Q 041414           28 AFECKTCNRQ   37 (152)
Q Consensus        28 ~~~C~~C~k~   37 (152)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            4578888876


Done!