Citrus Sinensis ID: 041430

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------120

MEPEGREKLLVDAQVSFGGFDRNVKAAELVKYLENEVGGVWRCRLKTSCTPSESYPDFYVTNTAEVRKTDDYEKVEPHAFVHFAMPTYVTRAVDAAGRTELFLNGRALKVSLGPENPFRLNQRGRTSTPFKLPDVCVEIGTLVSRDEFFVAWRGPASGTDFLVDPFDGTCKFCFTRDIAFALKSSTEHAVIKCEFKVEFLVREINLVKQYSEFSCVAILLQLASSPRVWYRTADDDILVLVPFDMLDDDDPWIRTTDFTPSGAIGRCNSYRISISSRHRGKLSKVITYLGERRVQVDSLSRPITIREEPDFEVPMSDPFFCIHYEEGISFEIMFLVNAVMHKGIINQHQLSDSFFDLLRGQSREVNVAALKHIYSYKWPVFDACKRLKLVQEWLLKDPELYKGPKQIDDIVEVRRLVITPTKAYCLPPEVELSNRVLRKYKDLADRFLRVTFMDEGLQTMNANVLSYFIAPIVRDITLNSFSQKTRVFKRVRSILSGGFYLCGRKFSFLAFSSSQLRDCSAWFFSEDGKTSVLDIKKWMGRFTDKNIAKCAARMGQCFSSTYATVEVPPTEVDPELPDIKRNGYVFSDGIGKITPDLAMEVAQKLKLDVNPPPCAYQIRYAGCKGVVACWPAKGDGIRMSLRESMNKFQSHHTTLEICSWTRFQPGFLNRQIITLLSTLNVPDEMFWSMQDSMLSKLNQMLVDSDVAFEVLTAACAEQGNTAAIMLSAGFNPQTEPHLRGMLTCIRAAQLWGLREKARIFVPAGRWLMGCLDELGVLEGGQCFIQVSEPFLGNCFSKHGSRFAETKKLQVIKGFVVIAKNPCLHPGDIRILEAVDHPELHHLYDCLVFPQKGDRPHTNEASGSDLDGDLYFVTWDENLIPPSKKSWPPMEYNAAEAKTLTRPVDQRDIIEFFAKHMVNENLGTICNAHVVHADHSEYGALDENCILLAELAATAVDFPKTGKIVTMPAHLKPKLYPDFMGKEAYQSYKSNKILGRLYRQSKDAYDEDISVSSEVDINPVDIHYDTDLEVPESVDFIADAWNQKCSYDGQLNGLLEQYKVNREEELVTGHIWSMPKYNSRKQGELKERLKHSYSALRKEFRQVFEKMDSDCELLSEDEKNALFERKASAWYQVTYHPEWVKKSLDLQEQDSARSVVLLSFAWIANDYLARIKIRCREMANIDTSKPVNYLARYVADRI

cccccccccEEEEEEEEEcccccccHHHHHHHHHHccccEEEEEccccccccccccccccccCEEECcccccccccccCEEEEcccHHHHHHHHHHcccEEEEccccccccccccccccccccccccccCECccEEEEEEEECcccCEEEEEEcccccccEEEcccccEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEccEEEEEEEcccccEEEEEEccccccEEEEcccccccccccccccccccccEEEcccccccccccEEEEEEEEEccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHcccHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccEEEEEEEEECccEEEEccccccccHHHHHHcccccccEEEEEEEccccccccccccccccccEEEccccccccccHHHHHHHHHHHcccCEEccCEEEEEEEcccccccccEEEECccccccHHHHHHHHcccccHHHHHHHHHHHccccccccCEECccccEEEcccccccccccccccCECccHHHHHHHHHHHcccccccccEEEEEEcccccEEEEccccccccEEEEcccccccccccccEEEEEccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccEEccccEEEEEEEcccccccccEEEEEEcccccccccccccccccccccEEEEEEEEEEEccccccccccEEEEECccccccccccEEEEccccccccccccccccccccEEEEEEcccccccccccccccccccHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHccccccccccEEEHHcHHHHHHHHHHHccccccccccccccHHHHHHHHcc

********LLVDAQVSFGGFDRNVKAAELVKYLENEVGGVWRCRLKTSCTPSESYPDFYVTNTAEVRKTDDYEKVEPHAFVHFAMPTYVTRAVDAAGRTELFLNGRALKVSLGPENPFRL*****TSTPFKLPDVCVEIGTLVSRDEFFVAWRGPASGTDFLVDPFDGTCKFCFTRDIAFALKSSTEHAVIKCEFKVEFLVREINLVKQYSEFSCVAILLQLASSPRVWYRTADDDILVLVPFDMLDDDDPWIRTTDFTPSGAIGRCNSYRISISSRHRGKLSKVITYLGERRVQVDSLSRPITIREEPDFEVPMSDPFFCIHYEEGISFEIMFLVNAVMHKGIINQHQLSDSFFDLLRGQSREVNVAALKHIYSYKWPVFDACKRLKLVQEWLLKDPELYKGPKQIDDIVEVRRLVITPTKAYCLPPEVELSNRVLRKYKDLADRFLRVTFMDEGLQTMNANVLSYFIAPIVRDITLNSFSQKTRVFKRVRSILSGGFYLCGRKFSFLAFSSSQLRDCSAWFFSEDGKTSVLDIKKWMGRFTDKNIAKCAARMGQCFSSTYATVEVPPTEVDPELPDIKRNGYVFSDGIGKITPDLAMEVAQKLKLDVNPPPCAYQIRYAGCKGVVACWPAKGDGIRMSLRESMNKFQSHHTTLEICSWTRFQPGFLNRQIITLLSTLNVPDEMFWSMQDSMLSKLNQMLVDSDVAFEVLTAACAEQGNTAAIMLSAGFNPQTEPHLRGMLTCIRAAQLWGLREKARIFVPAGRWLMGCLDELGVLEGGQCFIQVSEPFLGNCFSKHGSRFAETKKLQVIKGFVVIAKNPCLHPGDIRILEAVDHPELHHLYDCLVFPQKGDRPHTNEASGSDLDGDLYFVTWDENLIPPSKKSWPPMEYN***AKTLTRPVDQRDIIEFFAKHMVNENLGTICNAHVVHADHSEYGALDENCILLAELAATAVDFPKTGKIVTMPAHLKPKLYPDFMGKEAYQSYKSNKILGRLYRQSKDAYDEDISVSSEVDINPVDIHYDTDLEVPESVDFIADAWNQKCSYDGQLNGLLEQYKVNREEELVTGHIWSMP*************LKHSYSALRKEFRQVFEKMDS*C*L****EKNALFERKASAWYQVTYHPEWVKKSLDLQEQDSARSVVLLSFAWIANDYLARIKIRCR*********PVNY***YV****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable RNA-dependent RNA polymerase SHL2	Involved in the RNA silencing pathway. Probably required for the generation of small interfering RNAs (siRNAs). Regulates shoot apical meristem (SAM) initiation and maintenance and leaf polarization through the trans-acting siRNAS (ta-siRNAs) pathway which probably modulates the expression of the ARF2, ARF3, ARF4, ARF14 and ARF15 genes.	probable	Q8LHH9
RNA-dependent RNA polymerase 6	RNA-dependent RNA polymerase involved in post-transcriptional gene silencing (PTGS). Possesses ssRNA and ssDNA-dependent polymerase activity, but does not have priming activity. Possesses in vitro 3' nucleotidyltransferase activity in the presence of UTP as single nucleotide. Required for the production of 21 nucleotide trans-acting small interfering RNAs (ta-siRNAs) derived from TAS1, TAS2 and TAS3 endogenous transcripts. Acts in the RDR6/SGS3/DCL4/AGO7 ta-siRNA pathway involved in leaf developmental timing. Required for the production of natural siRNAs (nat-siRNAs) derived from cis-natural antisense transcripts. Required for the production of 24 nucleotide nat-siRNAs derived from the stress-related P5CDH-SRO5 antisense gene pair. Required for PTGS induced by transgene direct repeats. Plays an essential role in transitive silencing of transgenes by processing secondary siRNAs. This pathway, which requires DCL2 and DCL4, amplifies silencing by using the target RNA as substrate to generate secondary siRNAs, providing an efficient mechanism for long-distance silencing. Involved in the biogenesis of secondary siRNAs which require 22 nucleotide miRNAs associated to AGO1. Participates synergistically with AS1 and AS2 to proper plant development by repressing the miR165 and miR166 microRNAs (independently of AGO10) that may lead to mRNA degradation of genes in the class III HD-ZIP family. Required for the production of some small RNAs derived from the crucifer-infecting tobamovirus (TMV-cg). Required for sense virus-induced post-transcriptional gene silencing (S-PTGS).	probable	Q9SG02

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J7N, chain A
Confidence level:very confident
Coverage over the Query: 421-995
View the alignment between query and template
View the model in PyMOL

Template: 3UE2, chain A
Confidence level:probable
Coverage over the Query: 11-54,69-118
View the alignment between query and template
View the model in PyMOL