BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041440
(237 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q9VQE7|G23AA_DROME Putative gustatory receptor 23a, isoforms A/C OS=Drosophila
melanogaster GN=Gr23a PE=2 SV=3
Length = 415
Score = 30.8 bits (68), Expect = 9.3, Method: Compositional matrix adjust.
Identities = 11/42 (26%), Positives = 24/42 (57%)
Query: 56 SCCTRVCWIILVLFVIGISIGITLVILHKVYSPKGAILFIAD 97
S R CWI+ ++++ ++I + V + V + G +LF+ +
Sbjct: 36 SLAIRCCWIVYFIYLLDVAISFSWVAIENVGNAVGTMLFVGN 77
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.318 0.134 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 86,367,949
Number of Sequences: 539616
Number of extensions: 3509697
Number of successful extensions: 8714
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 8712
Number of HSP's gapped (non-prelim): 7
length of query: 237
length of database: 191,569,459
effective HSP length: 114
effective length of query: 123
effective length of database: 130,053,235
effective search space: 15996547905
effective search space used: 15996547905
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)