Citrus Sinensis ID: 041444

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------

MGSKIPQLHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANELGIELDVKTIKFPSVEAGLPDGCENLDAITNEVNKELIVKFLGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLRLYEPHKKVSSDSEPFVMPHFPGEIKLTRNQLPDFVKQDMGDNDLSRLLKATNESESRSYGVAVNSFYELEPAYADHYRKALGRRAWHIGPVSLCNRNFEDKALRGKQASIDELECLKWLNSKQPNSVVYICFGSLANFTSAQLMEIATGLEASGRNFIWVVRKNKNDGGEGGKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHEA

ccccccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHcccccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEEcccccccccccHHHccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHccccEEEcccccHHHHHcccc

****IPQLHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANELGIELDVKTIKFPSVEAGLPDGCENLDAITNEVNKELIVKFLGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLRLYEPHKK*SSDSEPFVMPHFPGEIKLTRNQLPDFVKQDMGDNDLSRLLKATNESESRSYGVAVNSFYELEPAYADHYRKALGRRAWHIGPVSLCNRNFEDK**RGKQASIDELECLKWLNSKQPNSVVYICFGSLANFTSAQLMEIATGLEASGRNFIWVVRKNKNDGGEGGKEDWLPEGFEKRMEGKGLIIRGWAPQVLILDHE*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-glucosyl transferase 73B2	Catalyzes the glycosylation of flavonoids from UDP-glucose. Uses a wide range of flavonoid substrates including flavonols (quercetin, kaempferol, isorhamnetin, 3-OH 7,2',4'-MeO-flavone), flavones (luteolin, apigenin), flavanones (naringenin, hesperetin), flavanonols (taxifolin), isoflavones (genistein, daidzein), flavonol glycosides (quercitrin, isoquercitrin, rutin), and chalcones (isoliquiritigenin). Specific for the C-7 position, with a 20-fold lower activity for the C-3 position.	probable	Q94C57

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.4.-.-	Glycosyltransferases.	probable
2.4.1.-	Hexosyltransferases.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PQ6, chain A
Confidence level:very confident
Coverage over the Query: 7-51,63-367
View the alignment between query and template
View the model in PyMOL

Template: 2VCE, chain A
Confidence level:confident
Coverage over the Query: 5-365
View the alignment between query and template
View the model in PyMOL