BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041456
         (92 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|B Chain B, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|C Chain C, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|D Chain D, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|E Chain E, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|F Chain F, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|G Chain G, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|H Chain H, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|I Chain I, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|J Chain J, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|K Chain K, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|L Chain L, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|M Chain M, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|N Chain N, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3V5E|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|B Chain B, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|C Chain C, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|D Chain D, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|E Chain E, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|F Chain F, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|G Chain G, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|H Chain H, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|I Chain I, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|J Chain J, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|K Chain K, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|L Chain L, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|M Chain M, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
 pdb|3V5E|N Chain N, Crystal Structure Of Clpp From Staphylococcus Aureus In
          The Active, Extended Conformation
          Length = 203

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTTEVGSF 72
          D+ S L K+RI+ LG     +V   I+++ L+LQ +D+EK IYLY+NS G +    F
Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGF 75


>pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From
          Staphylococcus Aureus
 pdb|3ST9|B Chain B, Crystal Structure Of Clpp In Heptameric Form From
          Staphylococcus Aureus
 pdb|3ST9|C Chain C, Crystal Structure Of Clpp In Heptameric Form From
          Staphylococcus Aureus
 pdb|3ST9|D Chain D, Crystal Structure Of Clpp In Heptameric Form From
          Staphylococcus Aureus
 pdb|3ST9|E Chain E, Crystal Structure Of Clpp In Heptameric Form From
          Staphylococcus Aureus
 pdb|3ST9|F Chain F, Crystal Structure Of Clpp In Heptameric Form From
          Staphylococcus Aureus
 pdb|3ST9|G Chain G, Crystal Structure Of Clpp In Heptameric Form From
          Staphylococcus Aureus
 pdb|3STA|V Chain V, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|A Chain A, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|B Chain B, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|C Chain C, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|E Chain E, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|F Chain F, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|G Chain G, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|I Chain I, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|K Chain K, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|L Chain L, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|M Chain M, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|N Chain N, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|S Chain S, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
 pdb|3STA|T Chain T, Crystal Structure Of Clpp In Tetradecameric Form From
          Staphylococcus Aureus
          Length = 197

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTTEVGSF 72
          D+ S L K+RI+ LG     +V   I+++ L+LQ +D+EK IYLY+NS G +    F
Sbjct: 21 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGF 77


>pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|B Chain B, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|C Chain C, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|D Chain D, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|E Chain E, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|F Chain F, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|G Chain G, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|H Chain H, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|I Chain I, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|J Chain J, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|K Chain K, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|L Chain L, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|M Chain M, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|N Chain N, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|O Chain O, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|P Chain P, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|Q Chain Q, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|R Chain R, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|S Chain S, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|T Chain T, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|U Chain U, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|V Chain V, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|W Chain W, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|X Chain X, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|Y Chain Y, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|Z Chain Z, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|AA Chain a, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
 pdb|3V5I|BB Chain b, The Crystal Structure Of The Mutant Clpp S98a
          (Staphylococcus Aureus)
          Length = 203

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTTEVGSF 72
          D+ S L K+RI+ LG     +V   I+++ L+LQ +D+EK IYLY+NS G +    F
Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGF 75


>pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme
 pdb|4HNK|B Chain B, Crystal Structure Of An Enzyme
 pdb|4HNK|C Chain C, Crystal Structure Of An Enzyme
 pdb|4HNK|D Chain D, Crystal Structure Of An Enzyme
 pdb|4HNK|E Chain E, Crystal Structure Of An Enzyme
 pdb|4HNK|F Chain F, Crystal Structure Of An Enzyme
 pdb|4HNK|G Chain G, Crystal Structure Of An Enzyme
 pdb|4HNK|H Chain H, Crystal Structure Of An Enzyme
 pdb|4HNK|I Chain I, Crystal Structure Of An Enzyme
 pdb|4HNK|J Chain J, Crystal Structure Of An Enzyme
 pdb|4HNK|K Chain K, Crystal Structure Of An Enzyme
 pdb|4HNK|L Chain L, Crystal Structure Of An Enzyme
 pdb|4HNK|M Chain M, Crystal Structure Of An Enzyme
 pdb|4HNK|N Chain N, Crystal Structure Of An Enzyme
          Length = 219

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%)

Query: 16  DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTTEVGSFLCH 75
           ++ S L   RI++L     P + E I+++ LYL+YE   KPI+LY+NSTG  +    +  
Sbjct: 34  NIPSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINL 93

Query: 76  ALVFFQISSINASEYI 91
             +   IS ++   YI
Sbjct: 94  NGITDVISIVDVINYI 109


>pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium
          Falciparum
 pdb|4GM2|B Chain B, The Crystal Structure Of A Peptidase From Plasmodium
          Falciparum
 pdb|4GM2|C Chain C, The Crystal Structure Of A Peptidase From Plasmodium
          Falciparum
 pdb|4GM2|D Chain D, The Crystal Structure Of A Peptidase From Plasmodium
          Falciparum
 pdb|4GM2|E Chain E, The Crystal Structure Of A Peptidase From Plasmodium
          Falciparum
 pdb|4GM2|F Chain F, The Crystal Structure Of A Peptidase From Plasmodium
          Falciparum
 pdb|4GM2|G Chain G, The Crystal Structure Of A Peptidase From Plasmodium
          Falciparum
          Length = 205

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%)

Query: 19 SYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTTEVGSFLCHALV 78
          S L   RI++L     P + E I+++ LYL+YE   KPI+LY+NSTG  +    +    +
Sbjct: 23 SLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGI 82

Query: 79 FFQISSINASEYI 91
             IS ++   YI
Sbjct: 83 TDVISIVDVINYI 95


>pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed
          State
 pdb|3TT6|B Chain B, Structure Of Clpp From Bacillus Subtilis In Compressed
          State
 pdb|3TT6|C Chain C, Structure Of Clpp From Bacillus Subtilis In Compressed
          State
 pdb|3TT6|D Chain D, Structure Of Clpp From Bacillus Subtilis In Compressed
          State
 pdb|3TT6|E Chain E, Structure Of Clpp From Bacillus Subtilis In Compressed
          State
 pdb|3TT6|F Chain F, Structure Of Clpp From Bacillus Subtilis In Compressed
          State
 pdb|3TT6|G Chain G, Structure Of Clpp From Bacillus Subtilis In Compressed
          State
          Length = 196

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          D+ S L K+RI+ LG +   +V   I+++ L+L  ED EK I LY+NS G +
Sbjct: 18 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGS 69


>pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|B Chain B, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|C Chain C, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|D Chain D, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|E Chain E, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|F Chain F, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|G Chain G, Structure Of Clpp In Complex With Adep1
 pdb|3KTJ|A Chain A, Structure Of Clpp In Complex With Adep2 In Monoclinic
          Crystal Form
 pdb|3KTJ|B Chain B, Structure Of Clpp In Complex With Adep2 In Monoclinic
          Crystal Form
 pdb|3KTJ|C Chain C, Structure Of Clpp In Complex With Adep2 In Monoclinic
          Crystal Form
 pdb|3KTJ|D Chain D, Structure Of Clpp In Complex With Adep2 In Monoclinic
          Crystal Form
 pdb|3KTJ|E Chain E, Structure Of Clpp In Complex With Adep2 In Monoclinic
          Crystal Form
 pdb|3KTJ|F Chain F, Structure Of Clpp In Complex With Adep2 In Monoclinic
          Crystal Form
 pdb|3KTJ|G Chain G, Structure Of Clpp In Complex With Adep2 In Monoclinic
          Crystal Form
 pdb|3KTK|A Chain A, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|B Chain B, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|C Chain C, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|D Chain D, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|E Chain E, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|F Chain F, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|G Chain G, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|H Chain H, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|I Chain I, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|J Chain J, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|K Chain K, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|L Chain L, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|M Chain M, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
 pdb|3KTK|N Chain N, Structure Of Clpp In Complex With Adep2 In Triclinic
          Crystal Form
          Length = 199

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          D+ S L K+RI+ LG +   +V   I+++ L+L  ED EK I LY+NS G +
Sbjct: 18 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGS 69


>pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic
          Crystal Form
 pdb|3KTG|B Chain B, Structure Of Clpp From Bacillus Subtilis In Monoclinic
          Crystal Form
 pdb|3KTG|C Chain C, Structure Of Clpp From Bacillus Subtilis In Monoclinic
          Crystal Form
 pdb|3KTG|D Chain D, Structure Of Clpp From Bacillus Subtilis In Monoclinic
          Crystal Form
 pdb|3KTG|E Chain E, Structure Of Clpp From Bacillus Subtilis In Monoclinic
          Crystal Form
 pdb|3KTG|F Chain F, Structure Of Clpp From Bacillus Subtilis In Monoclinic
          Crystal Form
 pdb|3KTG|G Chain G, Structure Of Clpp From Bacillus Subtilis In Monoclinic
          Crystal Form
 pdb|3KTH|A Chain A, Structure Of Clpp From Bacillus Subtilis In Orthorombic
          Crystal Form
 pdb|3KTH|B Chain B, Structure Of Clpp From Bacillus Subtilis In Orthorombic
          Crystal Form
 pdb|3KTH|C Chain C, Structure Of Clpp From Bacillus Subtilis In Orthorombic
          Crystal Form
 pdb|3KTH|D Chain D, Structure Of Clpp From Bacillus Subtilis In Orthorombic
          Crystal Form
 pdb|3KTH|E Chain E, Structure Of Clpp From Bacillus Subtilis In Orthorombic
          Crystal Form
 pdb|3KTH|F Chain F, Structure Of Clpp From Bacillus Subtilis In Orthorombic
          Crystal Form
 pdb|3KTH|G Chain G, Structure Of Clpp From Bacillus Subtilis In Orthorombic
          Crystal Form
          Length = 199

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          D+ S L K+RI+ LG +   +V   I+++ L+L  ED EK I LY+NS G +
Sbjct: 18 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGS 69


>pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With
          Dfp
 pdb|3TT7|B Chain B, Structure Of Clpp From Bacillus Subtilis In Complex With
          Dfp
 pdb|3TT7|C Chain C, Structure Of Clpp From Bacillus Subtilis In Complex With
          Dfp
 pdb|3TT7|D Chain D, Structure Of Clpp From Bacillus Subtilis In Complex With
          Dfp
 pdb|3TT7|E Chain E, Structure Of Clpp From Bacillus Subtilis In Complex With
          Dfp
 pdb|3TT7|F Chain F, Structure Of Clpp From Bacillus Subtilis In Complex With
          Dfp
 pdb|3TT7|G Chain G, Structure Of Clpp From Bacillus Subtilis In Complex With
          Dfp
          Length = 197

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          D+ S L K+RI+ LG +   +V   I+++ L+L  ED EK I LY+NS G +
Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGS 70


>pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|B Chain B, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|C Chain C, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|D Chain D, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|E Chain E, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|F Chain F, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|G Chain G, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|H Chain H, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|I Chain I, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|J Chain J, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|K Chain K, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|L Chain L, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|M Chain M, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|N Chain N, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL2|A Chain A, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|B Chain B, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|C Chain C, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|D Chain D, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|E Chain E, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|F Chain F, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|G Chain G, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|H Chain H, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|I Chain I, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|J Chain J, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|K Chain K, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|L Chain L, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|M Chain M, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
 pdb|2ZL2|N Chain N, Crystal Structure Of H.Pylori Clpp In Complex With The
          Peptide Nvlgftq
          Length = 196

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
          D+ S L K+RIV L      SV   I+A+ L+L+ ED EK I LY+NS G
Sbjct: 20 DIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDIGLYINSPG 69


>pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|B Chain B, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|C Chain C, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|D Chain D, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|E Chain E, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|F Chain F, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|G Chain G, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|H Chain H, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|I Chain I, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|J Chain J, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|K Chain K, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|L Chain L, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|M Chain M, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|N Chain N, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL4|A Chain A, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|B Chain B, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|C Chain C, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|D Chain D, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|E Chain E, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|F Chain F, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|G Chain G, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|H Chain H, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|I Chain I, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|J Chain J, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|K Chain K, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|L Chain L, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|M Chain M, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
 pdb|2ZL4|N Chain N, Crystal Structure Of H.Pylori Clpp S99a In Complex With
          The Peptide Aaaa
          Length = 196

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
          D+ S L K+RIV L      SV   I+A+ L+L+ ED EK I LY+NS G
Sbjct: 20 DIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDIGLYINSPG 69


>pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|B Chain B, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|C Chain C, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|D Chain D, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|E Chain E, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|F Chain F, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|G Chain G, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|H Chain H, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|I Chain I, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|J Chain J, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|K Chain K, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|L Chain L, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|M Chain M, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|N Chain N, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|O Chain O, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|P Chain P, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|Q Chain Q, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|R Chain R, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|S Chain S, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|T Chain T, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|U Chain U, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|V Chain V, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|W Chain W, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|X Chain X, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|Y Chain Y, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|Z Chain Z, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|1 Chain 1, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
 pdb|3HLN|2 Chain 2, Crystal Structure Of Clpp A153c Mutant With
          Inter-Heptamer Disulfide Bonds
          Length = 193

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
          D+ S L K R+++L       +  LI+A+ L+L+ E+ EK IYLY+NS G
Sbjct: 18 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPG 67


>pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|B Chain B, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|C Chain C, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|D Chain D, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|E Chain E, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|F Chain F, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|G Chain G, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|H Chain H, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|I Chain I, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|J Chain J, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|K Chain K, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|L Chain L, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|M Chain M, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1TYF|N Chain N, The Structure Of Clpp At 2.3 Angstrom Resolution
          Suggests A Model For Atp-Dependent Proteolysis
 pdb|1YG6|A Chain A, Clpp
 pdb|1YG6|B Chain B, Clpp
 pdb|1YG6|C Chain C, Clpp
 pdb|1YG6|D Chain D, Clpp
 pdb|1YG6|E Chain E, Clpp
 pdb|1YG6|F Chain F, Clpp
 pdb|1YG6|G Chain G, Clpp
 pdb|1YG6|H Chain H, Clpp
 pdb|1YG6|I Chain I, Clpp
 pdb|1YG6|J Chain J, Clpp
 pdb|1YG6|K Chain K, Clpp
 pdb|1YG6|L Chain L, Clpp
 pdb|1YG6|M Chain M, Clpp
 pdb|1YG6|N Chain N, Clpp
 pdb|2FZS|A Chain A, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|B Chain B, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|C Chain C, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|D Chain D, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|E Chain E, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|F Chain F, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|G Chain G, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|H Chain H, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|I Chain I, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|J Chain J, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|K Chain K, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|L Chain L, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|M Chain M, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|N Chain N, Crystal Structure Of E. Coli Clpp With A Peptide
          Chloromethyl Ketone Covalently Bound At The Active Site
          Length = 193

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
          D+ S L K R+++L       +  LI+A+ L+L+ E+ EK IYLY+NS G
Sbjct: 18 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPG 67


>pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|B Chain B, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|C Chain C, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|D Chain D, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|E Chain E, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|F Chain F, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|G Chain G, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|H Chain H, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|I Chain I, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|J Chain J, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|K Chain K, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|L Chain L, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|M Chain M, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|N Chain N, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|O Chain O, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|P Chain P, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|Q Chain Q, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|R Chain R, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|S Chain S, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|T Chain T, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|U Chain U, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|V Chain V, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|W Chain W, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|X Chain X, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|Y Chain Y, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|Z Chain Z, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|AA Chain a, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|BB Chain b, The Structure Of A V6a Variant Of Clpp
          Length = 193

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
          D+ S L K R+++L       +  LI+A+ L+L+ E+ EK IYLY+NS G
Sbjct: 18 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPG 67


>pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|S Chain S, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|T Chain T, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|U Chain U, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|O Chain O, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|P Chain P, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|Q Chain Q, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|Y Chain Y, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|Z Chain Z, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|AA Chain a, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|BB Chain b, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|V Chain V, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|W Chain W, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|X Chain X, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|M Chain M, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|L Chain L, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|K Chain K, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|J Chain J, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|I Chain I, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|H Chain H, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|N Chain N, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|F Chain F, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|E Chain E, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|D Chain D, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|C Chain C, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|B Chain B, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|A Chain A, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
 pdb|3MT6|G Chain G, Structure Of Clpp From Escherichia Coli In Complex With
          Adep1
          Length = 207

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
          D+ S L K R+++L       +  LI+A+ L+L+ E+ EK IYLY+NS G
Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPG 81


>pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|B Chain B, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|C Chain C, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|D Chain D, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|E Chain E, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|F Chain F, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|G Chain G, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
          Length = 277

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 16  DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
           D+ S L + RIV +      SV  L++A+ L+LQ E  +KPI++Y+NS G
Sbjct: 74  DIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPG 123


>pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit
          P From Francisella Tularensis
 pdb|3P2L|B Chain B, Crystal Structure Of Atp-Dependent Clp Protease Subunit
          P From Francisella Tularensis
 pdb|3P2L|C Chain C, Crystal Structure Of Atp-Dependent Clp Protease Subunit
          P From Francisella Tularensis
 pdb|3P2L|D Chain D, Crystal Structure Of Atp-Dependent Clp Protease Subunit
          P From Francisella Tularensis
 pdb|3P2L|E Chain E, Crystal Structure Of Atp-Dependent Clp Protease Subunit
          P From Francisella Tularensis
 pdb|3P2L|F Chain F, Crystal Structure Of Atp-Dependent Clp Protease Subunit
          P From Francisella Tularensis
 pdb|3P2L|G Chain G, Crystal Structure Of Atp-Dependent Clp Protease Subunit
          P From Francisella Tularensis
          Length = 201

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 8  TAWEQPPPDLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNS 63
          TA  +   D+ S L K RIV+L          L++A+ L+L+ ED +K IY Y+NS
Sbjct: 14 TAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDKDIYFYINS 69


>pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp
 pdb|1Y7O|B Chain B, The Structure Of Streptococcus Pneumoniae A153p Clpp
 pdb|1Y7O|C Chain C, The Structure Of Streptococcus Pneumoniae A153p Clpp
 pdb|1Y7O|D Chain D, The Structure Of Streptococcus Pneumoniae A153p Clpp
 pdb|1Y7O|E Chain E, The Structure Of Streptococcus Pneumoniae A153p Clpp
 pdb|1Y7O|F Chain F, The Structure Of Streptococcus Pneumoniae A153p Clpp
 pdb|1Y7O|G Chain G, The Structure Of Streptococcus Pneumoniae A153p Clpp
          Length = 218

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          D+ S L K+RI+ L      +    ++A+ L+L  +D+ K IYLY+N+ G +
Sbjct: 37 DIYSRLLKDRIIXLTGPVEDNXANSVIAQLLFLDAQDSTKDIYLYVNTPGGS 88


>pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|B Chain B, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|C Chain C, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|D Chain D, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|E Chain E, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|F Chain F, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|G Chain G, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|H Chain H, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|I Chain I, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|J Chain J, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|K Chain K, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|L Chain L, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|M Chain M, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|N Chain N, The 3.0 A Resolution Structure Of Caseinolytic Clp
          Protease 1 From Mycobacterium Tuberculosis
          Length = 206

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 21 LYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          L   RI++LG      +   + A+ L L  EDA K I LY+NS G +
Sbjct: 25 LLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGS 71


>pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|B Chain B, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|C Chain C, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|D Chain D, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|E Chain E, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|F Chain F, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|G Chain G, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|H Chain H, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|I Chain I, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|J Chain J, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|K Chain K, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|L Chain L, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|M Chain M, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CE3|N Chain N, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
          Length = 200

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 21 LYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          L   RI++LG      +   + A+ L L  EDA K I LY+NS G +
Sbjct: 24 LLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGS 70


>pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CBY|B Chain B, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CBY|C Chain C, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CBY|D Chain D, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CBY|E Chain E, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CBY|F Chain F, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
 pdb|2CBY|G Chain G, Crystal Structure Of The Atp-Dependent Clp Protease
          Proteolytic Subunit 1 (Clpp1) From Mycobacterium
          Tuberculosis
          Length = 208

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 21 LYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTGTT 67
          L   RI++LG      +   + A+ L L  EDA K I LY+NS G +
Sbjct: 24 LLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGS 70


>pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|B Chain B, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|C Chain C, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|D Chain D, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|E Chain E, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|F Chain F, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|G Chain G, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|H Chain H, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|I Chain I, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|J Chain J, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|K Chain K, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|L Chain L, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|M Chain M, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
 pdb|3Q7H|N Chain N, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
          Protease From Coxiella Burnetii
          Length = 195

 Score = 36.2 bits (82), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 16 DLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNSTG 65
          D+ S L K+R+++L          L +A+ L+L+ E+  K I LY+NS G
Sbjct: 20 DIYSRLLKDRVIFLVGQVEDHXANLAIAQXLFLESENPNKDINLYINSPG 69


>pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain
          From Plasmodium Falciparum
 pdb|2F6I|B Chain B, Crystal Structure Of The Clpp Protease Catalytic Domain
          From Plasmodium Falciparum
 pdb|2F6I|C Chain C, Crystal Structure Of The Clpp Protease Catalytic Domain
          From Plasmodium Falciparum
 pdb|2F6I|D Chain D, Crystal Structure Of The Clpp Protease Catalytic Domain
          From Plasmodium Falciparum
 pdb|2F6I|E Chain E, Crystal Structure Of The Clpp Protease Catalytic Domain
          From Plasmodium Falciparum
 pdb|2F6I|F Chain F, Crystal Structure Of The Clpp Protease Catalytic Domain
          From Plasmodium Falciparum
 pdb|2F6I|G Chain G, Crystal Structure Of The Clpp Protease Catalytic Domain
          From Plasmodium Falciparum
          Length = 215

 Score = 26.9 bits (58), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 4  FTSGTAWEQPPPDLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLNS 63
          F      +    D+  + +K RI+YL         + ++++ LYL   +    I +Y+NS
Sbjct: 19 FQGHMDIKDMKKDVKLFFFKKRIIYLTDEINKKTADELISQLLYLDNIN-HNDIKIYINS 77

Query: 64 TGTT 67
           G +
Sbjct: 78 PGGS 81


>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver
 pdb|1A4S|B Chain B, Betaine Aldehyde Dehydrogenase From Cod Liver
 pdb|1A4S|C Chain C, Betaine Aldehyde Dehydrogenase From Cod Liver
 pdb|1A4S|D Chain D, Betaine Aldehyde Dehydrogenase From Cod Liver
 pdb|1BPW|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver
 pdb|1BPW|B Chain B, Betaine Aldehyde Dehydrogenase From Cod Liver
 pdb|1BPW|C Chain C, Betaine Aldehyde Dehydrogenase From Cod Liver
 pdb|1BPW|D Chain D, Betaine Aldehyde Dehydrogenase From Cod Liver
          Length = 503

 Score = 25.8 bits (55), Expect = 6.3,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 30/75 (40%), Gaps = 16/75 (21%)

Query: 9   AWEQP--------PPDLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLY 60
           AW  P         P LA     N +V+      P V  +ILAE     + +A  P+ L 
Sbjct: 164 AWNYPFMIAAWKCAPALAC---GNAVVFKPSPMTP-VTGVILAEI----FHEAGVPVGLV 215

Query: 61  LNSTGTTEVGSFLCH 75
               G  E GS LCH
Sbjct: 216 NVVQGGAETGSLLCH 230


>pdb|3HHS|B Chain B, Crystal Structure Of Manduca Sexta Prophenoloxidase
          Length = 684

 Score = 25.8 bits (55), Expect = 6.8,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 13/69 (18%)

Query: 3   PFTSGTAWEQPPPDLASYLYKNRIVYLGMSFVPSVRELILAEFLYLQYEDAEKPIYLYLN 62
           P T  T W+Q   +L            G+ F P  R  +LA F +LQ+++ +  I +  N
Sbjct: 444 PNTLRTLWQQSTVELGR----------GLDFTP--RGSVLARFTHLQHDEFQYVIEVN-N 490

Query: 63  STGTTEVGS 71
           +TG   +G+
Sbjct: 491 TTGGNLMGT 499


>pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3K|B Chain B, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3K|C Chain C, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3K|D Chain D, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3K|E Chain E, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3K|F Chain F, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3L|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3L|B Chain B, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3L|C Chain C, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3L|D Chain D, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3L|E Chain E, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
 pdb|4B3L|F Chain F, Family 1 6-phospho-beta-d Glycosidase From Streptococcus
           Pyogenes
          Length = 479

 Score = 25.8 bits (55), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 5   TSGTAWEQPPPDLASYLYKNRIVYLGMSF 33
             G  W+  P +LA  + +NR+ YLG++F
Sbjct: 270 KDGVLWQSTPEELA-LIAENRVDYLGLNF 297


>pdb|3IKO|C Chain C, Crystal Structure Of The Heterotrimeric
           Sec13-Nup145c-Nup84 Nucleoporin Complex
 pdb|3IKO|F Chain F, Crystal Structure Of The Heterotrimeric
           Sec13-Nup145c-Nup84 Nucleoporin Complex
 pdb|3IKO|I Chain I, Crystal Structure Of The Heterotrimeric
           Sec13-Nup145c-Nup84 Nucleoporin Complex
          Length = 460

 Score = 25.4 bits (54), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 48  LQYEDAEKPIYLYLNSTGTTEVGSFL 73
           LQY D E  ++++LN    TE+ ++L
Sbjct: 277 LQYSDWESDLHIHLNQILQTEIENYL 302


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.139    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,799,432
Number of Sequences: 62578
Number of extensions: 100772
Number of successful extensions: 282
Number of sequences better than 100.0: 30
Number of HSP's better than 100.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 256
Number of HSP's gapped (non-prelim): 30
length of query: 92
length of database: 14,973,337
effective HSP length: 59
effective length of query: 33
effective length of database: 11,281,235
effective search space: 372280755
effective search space used: 372280755
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)