BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041465
(216 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From
Cryptosporidium Parvum, Cgd7_40
Length = 345
Score = 28.5 bits (62), Expect = 3.1, Method: Compositional matrix adjust.
Identities = 17/53 (32%), Positives = 24/53 (45%)
Query: 156 KLLHMVTSSTAKTLVQLVTVSICGCSAMTEVVINGKEGVEKEEIVFCKLKALI 208
KL + ST K + +V IC C E ING +E + F + + LI
Sbjct: 118 KLNVFIDDSTGKCAMDVVKTQICPCPECNEEAINGSIHGFRESLDFVQREKLI 170
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.139 0.408
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,529,638
Number of Sequences: 62578
Number of extensions: 194386
Number of successful extensions: 408
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 407
Number of HSP's gapped (non-prelim): 6
length of query: 216
length of database: 14,973,337
effective HSP length: 95
effective length of query: 121
effective length of database: 9,028,427
effective search space: 1092439667
effective search space used: 1092439667
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)