BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041521
(524 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3RFZ|B Chain B, Crystal Structure Of The Fimd Usher Bound To Its Cognate
Fimc:fimh Substrate
pdb|3RFZ|E Chain E, Crystal Structure Of The Fimd Usher Bound To Its Cognate
Fimc:fimh Substrate
Length = 843
Score = 30.8 bits (68), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
Query: 314 THIPIIAPKISVASYFNKRHTERNQKTSYSITVQ-GVVDTKGVFTD 358
T+I ++ + S + YFN T ++ Y+I Q GV+ K FTD
Sbjct: 427 TNIQLVGYRYSTSGYFNFADTTYSRMNGYNIETQDGVIQVKPKFTD 472
>pdb|3OHN|A Chain A, Crystal Structure Of The Fimd Translocation Domain
pdb|3OHN|B Chain B, Crystal Structure Of The Fimd Translocation Domain
Length = 558
Score = 30.4 bits (67), Expect = 2.5, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
Query: 314 THIPIIAPKISVASYFNKRHTERNQKTSYSITVQ-GVVDTKGVFTD 358
T+I ++ + S + YFN T ++ Y+I Q GV+ K FTD
Sbjct: 304 TNIQLVGYRYSTSGYFNFADTTYSRMNGYNIETQDGVIQVKPKFTD 349
>pdb|1SI9|A Chain A, Boiling Stable Protein Isolated From Populus Tremula
pdb|1SI9|B Chain B, Boiling Stable Protein Isolated From Populus Tremula
pdb|1SI9|C Chain C, Boiling Stable Protein Isolated From Populus Tremula
pdb|1TR0|A Chain A, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|B Chain B, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|C Chain C, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|D Chain D, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|E Chain E, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|F Chain F, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|G Chain G, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|H Chain H, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|I Chain I, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|J Chain J, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|K Chain K, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|L Chain L, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|M Chain M, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|N Chain N, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|O Chain O, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|P Chain P, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|R Chain R, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|S Chain S, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|T Chain T, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|U Chain U, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|V Chain V, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|W Chain W, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|X Chain X, Crystal Structure Of A Boiling Stable Protein Sp1
pdb|1TR0|Y Chain Y, Crystal Structure Of A Boiling Stable Protein Sp1
Length = 108
Score = 30.0 bits (66), Expect = 2.9, Method: Composition-based stats.
Identities = 14/26 (53%), Positives = 18/26 (69%)
Query: 2 EITRFPFLNQEEDYSHLLDLLPEMES 27
EITR N DY++LLDL+P M+S
Sbjct: 20 EITREQIDNYINDYTNLLDLIPSMKS 45
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,597,503
Number of Sequences: 62578
Number of extensions: 561217
Number of successful extensions: 1109
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1104
Number of HSP's gapped (non-prelim): 7
length of query: 524
length of database: 14,973,337
effective HSP length: 103
effective length of query: 421
effective length of database: 8,527,803
effective search space: 3590205063
effective search space used: 3590205063
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)