Citrus Sinensis ID: 041566

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------
MPRPPNYEFQDWWNKQRENGHDVVPEKYECTTNSDNINNNNNNNSNHHHPNSPFLTVEIRNPSSDPAVDKEMRARSVRQLSGIYLLKLQQIAYSVVYAVIYVVRTIQSRSASDSSHSRFYRAIKWMLILVISLLCFELAAYFKGWHFSPPTAETAELMVEFVYATWLQVRADYLAPPLKSLGHTCIVLFLIQSLDRLVLVIGCAWIKFKKVKPKAAMAYPVGKGDDEDLEDYPMVLVQIPMCNEREVYGQSIAAVCIQDWPKERMLVQILDDSDDLDVQLLIKAEVLKWQQRGVHIIYRHRLIRSGYKAGNLNSAMGCDYVKDYEFVAIFDADFQPTPDFLKKTIPYFKGNDDLALVQTRWSFVNKDENLLTRLQNINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEECGGWLDRTTVEDMDIAVRAHLCGWKFVYVNDVKCLCELPESYEAYKKQQHRWHSGPMQLFRMCFIDIIRSKVSWAKKANLIFLFFLLRKLVLPFYSFTLFCIILPLTMFIPEAELPAWVVSYVPGFMSILNILPAPRSFPFIVPYLLFENTMSVTKFNAMISGLFRFGSSYEWIVTKKLGRSSEADLVAFAEKESDSTFPRSTSESGIAQMNRLGVTRKTERRNKLYRKELALAFILLTASVRSLLSAQGMHFYFLLFQGISFLLVGLDLIGEQ
ccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHccccEEEEEEcccccccEEccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHccccccc
*****NY*FQDWWNKQRENGHDVVPEKYE******************HHPNSPF***********************RQLSGIYLLKLQQIAYSVVYAVIYVVRTIQSRSASDSSHSRFYRAIKWMLILVISLLCFELAAYFKGWHFSPPTAETAELMVEFVYATWLQVRADYLAPPLKSLGHTCIVLFLIQSLDRLVLVIGCAWIKFKKVKPKAAMAYPVGKGDDEDLEDYPMVLVQIPMCNEREVYGQSIAAVCIQDWPKERMLVQILDDSDDLDVQLLIKAEVLKWQQRGVHIIYRHRLIRSGYKAGNLNSAMGCDYVKDYEFVAIFDADFQPTPDFLKKTIPYFKGNDDLALVQTRWSFVNKDENLLTRLQNINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEECGGWLDRTTVEDMDIAVRAHLCGWKFVYVNDVKCLCELPESYEAYKKQQHRWHSGPMQLFRMCFIDIIRSKVSWAKKANLIFLFFLLRKLVLPFYSFTLFCIILPLTMFIPEAELPAWVVSYVPGFMSILNILPAPRSFPFIVPYLLFENTMSVTKFNAMISGLFRFGSSYEWIVTKKLGRSSEADLVAFAE***********S*SGIAQMNRLGVTRKTERRNKLYRKELALAFILLTASVRSLLSAQGMHFYFLLFQGISFLLVGLDLIGEQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRPPNYEFQDWWNKQRENGHDVVPEKYECTTNSDNINNNNNNNSNHHHPNSPFLTVEIRNPSSDPAVDKEMRARSVRQLSGIYLLKLQQIAYSVVYAVIYVVRTIQSRSASDSSHSRFYRAIKWMLILVISLLCFELAAYFKGWHFSPPTAETAELMVEFVYATWLQVRADYLAPPLKSLGHTCIVLFLIQSLDRLVLVIGCAWIKFKKVKPKAAMAYPVGKGDDEDLEDYPMVLVQIPMCNEREVYGQSIAAVCIQDWPKERMLVQILDDSDDLDVQLLIKAEVLKWQQRGVHIIYRHRLIRSGYKAGNLNSAMGCDYVKDYEFVAIFDADFQPTPDFLKKTIPYFKGNDDLALVQTRWSFVNKDENLLTRLQNINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEECGGWLDRTTVEDMDIAVRAHLCGWKFVYVNDVKCLCELPESYEAYKKQQHRWHSGPMQLFRMCFIDIIRSKVSWAKKANLIFLFFLLRKLVLPFYSFTLFCIILPLTMFIPEAELPAWVVSYVPGFMSILNILPAPRSFPFIVPYLLFENTMSVTKFNAMISGLFRFGSSYEWIVTKKLGRSSEADLVAFAEKESDSTFPRSTSESGIAQMNRLGVTRKTERRNKLYRKELALAFILLTASVRSLLSAQGMHFYFLLFQGISFLLVGLDLIGEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable xyloglucan glycosyltransferase 6 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.confidentQ9SRT3
Probable xyloglucan glycosyltransferase 7 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.probableQ6L538
Probable xyloglucan glycosyltransferase 9 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.probableQ6AU53

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.32Glucomannan 4-beta-mannosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HG6, chain A
Confidence level:very confident
Coverage over the Query: 148-595
View the alignment between query and template
View the model in PyMOL