Citrus Sinensis ID: 041592


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MGTKTWHLALVIVLMIILNLSTISRVDGEQQVPCYFIFGDSLLDNGNNNALQTNVKANYLPYGIDFPTGPTGRFSNGRNIADITAELLGFVEYIPSFATARGREILKGVNYASGGAGIRDETGQNLGTVISFSKQLLNHKTTVSRIVSLLGDEKSTEKNLSKCIYTVGIGSNDYINNYLMPQFYPTSRLHMPDQYAALLIEQYSQQLKTLYSYGARKVALFGIGPIGCTPGNIATYDTNGSLCVDFINKAVQEFNIRLKTLVDNLNHNLQDAKFIYVNVYGISSGPLAGLQGPNPCCSVANIANNGGILTCIPFSPPCPVRALEVFYDATHPTEAANLVVAGRSYVSLLPSDTHPIDIRQLARL
cccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHccccEEEEEEcccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHccccccccccccHHHHHcc
****TWHLALVIVLMIILNLSTISRVDGEQQVPCYFIFGDSLLDNGNNNALQTNVKANYLPYGIDFPTGPTGRFSNGRNIADITAELLGFVEYIPSFATARGREILKGVNYASGGAGIRDETGQNLGTVISFSKQLLNHKTTVSRIVSLLGDEKSTEKNLSKCIYTVGIGSNDYINNYLMPQFYPTSRLHMPDQYAALLIEQYSQQLKTLYSYGARKVALFGIGPIGCTPGNIATYDTNGSLCVDFINKAVQEFNIRLKTLVDNLNHNLQDAKFIYVNVYGISSGPLAGLQGPNPCCSVANIANNGGILTCIPFSPPCPVRALEVFYDATHPTEAANLVVAGRSYVSLLPSDTHPIDIRQLARL
xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTKTWHLALVIVLMIILNLSTISRVDGEQQVPCYFIFGDSLLDNGNNNALQTNVKANYLPYGIDFPTGPTGRFSNGRNIADITAELLGFVEYIPSFATARGREILKGVNYASGGAGIRDETGQNLGTVISFSKQLLNHKTTVSRIVSLLGDEKSTEKNLSKCIYTVGIGSNDYINNYLMPQFYPTSRLHMPDQYAALLIEQYSQQLKTLYSYGARKVALFGIGPIGCTPGNIATYDTNGSLCVDFINKAVQEFNIRLKTLVDNLNHNLQDAKFIYVNVYGISSGPLAGLQGPNPCCSVANIANNGGILTCIPFSPPCPVRALEVFYDATHPTEAANLVVAGRSYVSLLPSDTHPIDIRQLARL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GDSL esterase/lipase At1g29660 probableQ9C7N5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KVN, chain X
Confidence level:very confident
Coverage over the Query: 28-180,192-363
View the alignment between query and template
View the model in PyMOL
Template: 1ESC, chain A
Confidence level:confident
Coverage over the Query: 33-49,60-139,159-347
View the alignment between query and template
View the model in PyMOL