Citrus Sinensis ID: 041602


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MSRVYVGNLDPRVSERDLEDEFRMFGVLRSVWVARRPPGYAFVEFDDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFARECRLRIGSRGLGSGRRRSPSPRRRRSPSYGYGRRCGSRAMSSSAMAQGSYTYESCNSINVESVSSPLQLQRYGYQFREICVMSLIFYPSNLFSIFLVLYCIQLYLSSILLGGEFNTPLSTF
cccEEEccccccccHHHHHHHHHccccEEEEEECcccccEEEEEEccHHHHHHHHHHHccccccEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccc
MSRVYVGNLDPRVSERDLEDEFRMFGVLRSVWVARRPPGYAFVEFDDRRDAVDAIRALDGKNGWRV***********************KCYECGEPGHFARECRLRI*******************************************YTYESCNSINVESVSSPLQLQRYGYQFREICVMSLIFYPSNLFSIFLVLYCIQLYLSSILLGGEFNTPL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRVYVGNLDPRVSERDLEDEFRMFGVLRSVWVARRPPGYAFVEFDDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFARECRLRIGSRGLGSGRRRSPSPRRRRSPSYGYGRRCGSRAMSSSAMAQGSYTYESCNSINVESVSSPLQLQRYGYQFREICVMSLIFYPSNLFSIFLVLYCIQLYLSSILLGGEFNTPLSTF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/arginine-rich splicing factor RSZ22 Sequence-specific RNA-binding protein probably involved in pre-mRNA splicing. In vitro, can complement efficiently splicing-deficient mammalian SRSF7-depleted HeLa cell extract.probableO81126

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 2-74
View the alignment between query and template
View the model in PyMOL
Template: 3TS2, chain A
Confidence level:confident
Coverage over the Query: 20-107
View the alignment between query and template
View the model in PyMOL