Citrus Sinensis ID: 041604

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
CIAGFIVIVLNNFQDQLVFYVTPSEALEKYQSNPSKNKFRLGGLVLEGSVAHPASSSEMEFVVTDLVTDILVRYQGSLPDLFREGHSVVVEGFIKPITEEIKNVKSEKSVSENARSRDCFFSATDVLAKHDEKYMPQEVAAAIEKNKKMLEEQQQEEGGKDS
cHHHHHHHHHHHHHccEEEEEcHHHHHHcccccccccEEEEEEEEEcccEEEcccccEEEEEEEEcccEEEEEEccccccccccccEEEEEEEEccccHHHHcccccccccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccc
CIAGFIVIVLNNFQDQLVFYVTPSEALE*******KNKFRLGGLVLEGSVAHPASSSEMEFVVTDLVTDILVRYQGSLPDLFREGHSVVVEGFIKPIT*******************DCFFSATDVLAKHDEKYM***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CIAGFIVIVLNNFQDQLVFYVTPSEALEKYQSNPSKNKFRLGGLVLEGSVAHPASSSEMEFVVTDLVTDILVRYQGSLPDLFREGHSVVVEGFIKPITEEIKNVKSEKSVSENARSRDCFFSATDVLAKHDEKYMPQEVAAAIEKNKKMLEEQQQEEGGKDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c-type biogenesis protein CcmE Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH.probableB2UBM4
Cytochrome c-type biogenesis protein CcmE Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH.probableB5ZVF6
Cytochrome c-type biogenesis protein CcmE Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH.probableQ46RW7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J6Q, chain A
Confidence level:very confident
Coverage over the Query: 15-96,118-130
View the alignment between query and template
View the model in PyMOL