BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041607
         (92 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ODB|B Chain B, The Crystal Structure Of Human Cdc42 In Complex With The
          Crib Domain Of Human P21-Activated Kinase 6 (Pak6)
          Length = 35

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 52 EIGCPTNVRHITHATFD-RFNDFLGLPVEFE 81
          EI  P N +H  H +FD +   F+GLP +++
Sbjct: 1  EISAPQNFQHRVHTSFDPKEGKFVGLPPQWQ 31


>pdb|4FIE|A Chain A, Full-Length Human Pak4
 pdb|4FIE|B Chain B, Full-Length Human Pak4
          Length = 423

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 51 MEIGCPTNVRHITHATFDRF-NDFLGLPVEFE 81
          +EI  P+N  H  H  FD+    F GLP +++
Sbjct: 6  VEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQ 37


>pdb|2OV2|I Chain I, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
 pdb|2OV2|J Chain J, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
 pdb|2OV2|K Chain K, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
 pdb|2OV2|L Chain L, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
 pdb|2OV2|M Chain M, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
 pdb|2OV2|N Chain N, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
 pdb|2OV2|O Chain O, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
 pdb|2OV2|P Chain P, The Crystal Structure Of The Human Rac3 In Complex With
          The Crib Domain Of Human P21-Activated Kinase 4 (Pak4)
          Length = 35

 Score = 26.6 bits (57), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%)

Query: 52 EIGCPTNVRHITHATFDRFND-FLGLP 77
          EI  P+N  H  H  FD+    F GLP
Sbjct: 1  EISAPSNFEHRVHTGFDQHEQKFTGLP 27


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.135    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,241,078
Number of Sequences: 62578
Number of extensions: 72698
Number of successful extensions: 136
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 136
Number of HSP's gapped (non-prelim): 3
length of query: 92
length of database: 14,973,337
effective HSP length: 59
effective length of query: 33
effective length of database: 11,281,235
effective search space: 372280755
effective search space used: 372280755
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)