Query         041618
Match_columns 129
No_of_seqs    100 out of 117
Neff          2.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:00:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041618.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041618hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05553 DUF761:  Cotton fibre   99.6 1.7E-15 3.6E-20   94.6   4.6   34   87-121     1-34  (38)
  2 PF02898 NO_synthase:  Nitric o  54.6     8.8 0.00019   34.3   2.0   33   87-119     5-37  (372)
  3 PF11485 DUF3211:  Protein of u  46.8      26 0.00057   27.1   3.4   23   89-111   110-132 (136)
  4 COG4443 Uncharacterized protei  45.8      11 0.00025   26.8   1.1   22   40-62     28-49  (72)
  5 COG4362 Nitric oxide synthase,  40.8      22 0.00048   31.5   2.3   21   89-109     5-25  (355)
  6 cd00795 NOS_oxygenase_euk Nitr  33.3      38 0.00083   30.8   2.7   22   87-108    51-72  (412)
  7 cd02987 Phd_like_Phd Phosducin  27.1      93   0.002   23.8   3.5   23   89-115    30-52  (175)
  8 PF07240 Turandot:  Stress-indu  24.2   1E+02  0.0022   22.3   3.1   21   87-107    28-48  (85)
  9 TIGR03687 pupylate_cterm ubiqu  22.0      90  0.0019   19.4   2.1   14   91-104    16-29  (33)
 10 KOG3446 NADH:ubiquinone oxidor  19.9      70  0.0015   23.9   1.6   13   95-107    32-44  (97)

No 1  
>PF05553 DUF761:  Cotton fibre expressed protein;  InterPro: IPR008480 This family consists of several plant proteins of unknown function. Three of the sequences from Gossypium hirsutum (Upland cotton) in this family are described as G. hirsutum fibre expressed proteins []. The remaining sequences, found in Arabidopsis thaliana, are uncharacterised.
Probab=99.59  E-value=1.7e-15  Score=94.62  Aligned_cols=34  Identities=53%  Similarity=0.870  Sum_probs=32.0

Q ss_pred             CchhHhHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 041618           87 SEDDIDKRAEMFIANFHRQLQIERQISLELRYCRA  121 (129)
Q Consensus        87 ~dd~ID~rAE~FI~kF~~QmrLQRq~Sl~lRY~~~  121 (129)
                      ++++||++||+||++||+||||||++|++ ||+++
T Consensus         1 ~~~evd~rAe~FI~~f~~qlrlqr~~S~~-ry~em   34 (38)
T PF05553_consen    1 SDDEVDRRAEEFIAKFREQLRLQRQESLQ-RYQEM   34 (38)
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHH
Confidence            47899999999999999999999999996 99986


No 2  
>PF02898 NO_synthase:  Nitric oxide synthase, oxygenase domain;  InterPro: IPR004030 Nitric oxide synthase (1.14.13.39 from EC) (NOS) enzymes produce nitric oxide (NO) by catalysing a five-electron oxidation of a guanidino nitrogen of L-arginine (L-Arg). Oxidation of L-Arg to L-citrulline occurs via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine as an intermediate. 2 mol of O(2) and 1.5 mol of NADPH are consumed per mole of NO formed []. Arginine-derived NO synthesis has been identified in mammals, fish, birds, invertebrates, plants, and bacteria []. Best studied are mammals, where three distinct genes encode NOS isozymes: neuronal (nNOS or NOS-1), cytokine-inducible (iNOS or NOS-2) and endothelial (eNOS or NOS-3) []. iNOS and nNOS are soluble and found predominantly in the cytosol, while eNOS is membrane associated. The enzymes exist as homodimers, each monomer consisting of two major domains: an N-terminal oxygenase domain, which belongs to the class of haem-thiolate proteins, and a C-terminal reductase domain, which is homologous to NADPH:P450 reductase (1.6.2.4 from EC). The interdomain linker between the oxygenase and reductase domains contains a calmodulin (CaM)-binding sequence. NOSs are the only enzymes known to simultaneously require five bound cofactors animal NOS isozymes are catalytically self-sufficient. The electron flow in the NO synthase reaction is: NADPH --> FAD --> FMN --> haem --> O(2). eNOS localisation to endothelial membranes is mediated by cotranslational N-terminal myristoylation and post-translational palmitoylation []. The subcellular localisation of nNOS in skeletal muscle is mediated by anchoring of nNOS to dystrophin. nNOS contains an additional N-terminal domain, the PDZ domain []. Some bacteria, like Bacillus halodurans, Bacillus subtilis or Deinococcus radiodurans, contain homologs of NOS oxygenase domain. The pattern is directed against the N-terminal haem binding site. This entry represents the oxygenase domain of NOS.; GO: 0004517 nitric-oxide synthase activity, 0006809 nitric oxide biosynthetic process, 0055114 oxidation-reduction process; PDB: 2FBZ_X 2AMO_A 2AN0_A 1M7V_A 2FC1_A 2FC2_B 1M7Z_A 2AN2_A 2ORS_A 1QW5_B ....
Probab=54.64  E-value=8.8  Score=34.26  Aligned_cols=33  Identities=21%  Similarity=0.291  Sum_probs=24.6

Q ss_pred             CchhHhHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 041618           87 SEDDIDKRAEMFIANFHRQLQIERQISLELRYC  119 (129)
Q Consensus        87 ~dd~ID~rAE~FI~kF~~QmrLQRq~Sl~lRY~  119 (129)
                      ..|+|-..|++||..||..++-+..+...-|-.
T Consensus         5 ~~e~l~~~A~~Fi~~~y~e~~~~~~~~~~~Rl~   37 (372)
T PF02898_consen    5 SKEELLEEAKEFIDQYYSELKRSGSEAHERRLE   37 (372)
T ss_dssp             THHHHHHHHHHHHHHHHHHTTSTTCHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHhcCCccchHHHHHHH
Confidence            468999999999999999877554444444443


No 3  
>PF11485 DUF3211:  Protein of unknown function (DUF3211);  InterPro: IPR021578  This archaeal family of proteins has no known function. ; PDB: 2EJX_A.
Probab=46.83  E-value=26  Score=27.12  Aligned_cols=23  Identities=30%  Similarity=0.361  Sum_probs=20.9

Q ss_pred             hhHhHHHHHHHHHHHHHHHHHHH
Q 041618           89 DDIDKRAEMFIANFHRQLQIERQ  111 (129)
Q Consensus        89 d~ID~rAE~FI~kF~~QmrLQRq  111 (129)
                      --++++-+.|.++|.+.+||+|-
T Consensus       110 ~~i~~~i~~f~~~ldE~IRlERI  132 (136)
T PF11485_consen  110 FFISKWIEKFKKNLDEEIRLERI  132 (136)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhhhhHHHHHHhH
Confidence            46889999999999999999985


No 4  
>COG4443 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.77  E-value=11  Score=26.81  Aligned_cols=22  Identities=32%  Similarity=0.356  Sum_probs=19.0

Q ss_pred             cccccCCCCCccccccCCCCCCC
Q 041618           40 RRLSFNDRPGLRACTDDNYADES   62 (129)
Q Consensus        40 rrlSFn~~pgL~~~~d~~~~d~~   62 (129)
                      -|+|||.||-=-|. -+|+|||.
T Consensus        28 n~vSwNg~~~KyDi-R~Wspdh~   49 (72)
T COG4443          28 NRVSWNGRPPKYDI-RAWSPDHS   49 (72)
T ss_pred             hhcccCCCCCcCcc-cccCcchh
Confidence            48999999988885 48999998


No 5  
>COG4362 Nitric oxide synthase, oxygenase domain [Inorganic ion transport and metabolism / Amino acid transport and metabolism]
Probab=40.76  E-value=22  Score=31.45  Aligned_cols=21  Identities=24%  Similarity=0.434  Sum_probs=17.4

Q ss_pred             hhHhHHHHHHHHHHHHHHHHH
Q 041618           89 DDIDKRAEMFIANFHRQLQIE  109 (129)
Q Consensus        89 d~ID~rAE~FI~kF~~QmrLQ  109 (129)
                      +.+-..|++||.|||++|-|.
T Consensus         5 ~~L~~ea~aFl~~~yeE~g~~   25 (355)
T COG4362           5 AVLTPEARAFLRRFYEEMGIE   25 (355)
T ss_pred             hhhCHHHHHHHHHHHHHhCcc
Confidence            456678999999999999854


No 6  
>cd00795 NOS_oxygenase_euk Nitric oxide synthase (NOS) eukaryotic oxygenase domain. NOS produces nitric oxide (NO) by catalyzing a five-electron heme-based oxidation of a guanidine nitrogen of L-arginine to L-citrulline via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine (NHA) as an intermediate. In mammals, there are three distinct NOS isozymes: neuronal (nNOS or NOS-1), cytokine-inducible (iNOS or NOS-2) and endothelial (eNOS or NOS-3) . Nitric oxide synthases are homodimers. In eukaryotes, each monomer has an N-terminal oxygenase domain, which binds to the substrate L-Arg,  zinc, and to the cofactors heme and 5.6.7.8-(6R)-tetrahydrobiopterin (BH4) . Eukaryotic NOS's also have a C-terminal electron supplying reductase region, which is homologous to cytochrome P450 reductase and binds NADH, FAD and FMN.
Probab=33.33  E-value=38  Score=30.76  Aligned_cols=22  Identities=14%  Similarity=0.357  Sum_probs=18.6

Q ss_pred             CchhHhHHHHHHHHHHHHHHHH
Q 041618           87 SEDDIDKRAEMFIANFHRQLQI  108 (129)
Q Consensus        87 ~dd~ID~rAE~FI~kF~~QmrL  108 (129)
                      ..+++-..|++||..||..++.
T Consensus        51 ~~e~l~~eA~~Fi~~~y~e~~~   72 (412)
T cd00795          51 PKEELLPQAKDFINQYYSSIKR   72 (412)
T ss_pred             CHHHHHHHHHHHHHHHHHhhcC
Confidence            4577889999999999987764


No 7  
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions. It specifically binds G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane. This impedes the formation of a functional G protein trimer (G protein alphabetagamma), thereby inhibiting G protein-mediated signal transduction. Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.
Probab=27.14  E-value=93  Score=23.78  Aligned_cols=23  Identities=30%  Similarity=0.442  Sum_probs=11.9

Q ss_pred             hhHhHHHHHHHHHHHHHHHHHHHHHHH
Q 041618           89 DDIDKRAEMFIANFHRQLQIERQISLE  115 (129)
Q Consensus        89 d~ID~rAE~FI~kF~~QmrLQRq~Sl~  115 (129)
                      |++|.-.|+|+.    ++|-||...++
T Consensus        30 d~~~~~~e~~l~----~~R~~R~~el~   52 (175)
T cd02987          30 DDDDEDKEEFLQ----QYREQRMQEMH   52 (175)
T ss_pred             hhhhhhHHHHHH----HHHHHHHHHHH
Confidence            444444444554    45555666665


No 8  
>PF07240 Turandot:  Stress-inducible humoral factor Turandot;  InterPro: IPR010825 This family consists of several Drosophila species specific Turandot proteins. The Turandot A (TotA) gene encodes a humoral factor, which is secreted from the fat body and accumulates in the body fluids. TotA is strongly induced upon bacterial challenge, as well as by other types of stress such as high temperature, mechanical pressure, dehydration, UV irradiation, and oxidative agents. It is also upregulated during metamorphosis and at high age. Flies that overexpress TotA show prolonged survival and retain normal activity at otherwise lethal temperatures. Although TotA is only induced by severe stress, it responds to a much wider range of stimuli than heat shock genes such as hsp70 or immune genes such as Cecropin A1 [].
Probab=24.21  E-value=1e+02  Score=22.32  Aligned_cols=21  Identities=14%  Similarity=0.264  Sum_probs=17.6

Q ss_pred             CchhHhHHHHHHHHHHHHHHH
Q 041618           87 SEDDIDKRAEMFIANFHRQLQ  107 (129)
Q Consensus        87 ~dd~ID~rAE~FI~kF~~Qmr  107 (129)
                      ...+...++|.||++|.++-.
T Consensus        28 L~~~~r~~~d~~i~~y~~~~~   48 (85)
T PF07240_consen   28 LTPQDRQRIDRFIRRYKEENN   48 (85)
T ss_pred             CCHHHHHHHHHHHHHHHHHhh
Confidence            467888999999999998753


No 9  
>TIGR03687 pupylate_cterm ubiquitin-like protein Pup. Members of this protein family are Pup, a small protein whose ligation to target proteins steers them toward degradation. This protein family occurs in a number of bacteria, especially Actinobacteria such as Mycobacterium tuberculosis, that possess an archeal-type proteasome. All members of this protein family known during model construction end with the C-terminal motif [FY][VI]QKGG[QE]. Ligation is thought to occur between the C-terminal COOH of Pup and an epsilon-amino group of a Lys on the target protein. The N-terminal half of this protein is poorly conserved and not represented in the seed alignment.
Probab=21.98  E-value=90  Score=19.39  Aligned_cols=14  Identities=29%  Similarity=0.627  Sum_probs=11.0

Q ss_pred             HhHHHHHHHHHHHH
Q 041618           91 IDKRAEMFIANFHR  104 (129)
Q Consensus        91 ID~rAE~FI~kF~~  104 (129)
                      +..-||+|.+.|-|
T Consensus        16 Le~NAe~FV~~fVQ   29 (33)
T TIGR03687        16 LESNAEEFVRGFVQ   29 (33)
T ss_pred             HHHhHHHHHHHHHH
Confidence            34579999999975


No 10 
>KOG3446 consensus NADH:ubiquinone oxidoreductase NDUFA2/B8 subunit [Energy production and conversion]
Probab=19.89  E-value=70  Score=23.95  Aligned_cols=13  Identities=23%  Similarity=0.473  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHH
Q 041618           95 AEMFIANFHRQLQ  107 (129)
Q Consensus        95 AE~FI~kF~~Qmr  107 (129)
                      ..+||+|||-.+|
T Consensus        32 vR~fvEk~Y~~lK   44 (97)
T KOG3446|consen   32 VREFVEKFYVNLK   44 (97)
T ss_pred             HHHHHHHhhhhhh
Confidence            4689999999987


Done!