Citrus Sinensis ID: 041619

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MGCVCMKQRLKSVNHAALAAQTHFKETEIEILYLLFKKLSSSLVDDGIISKEEFQLGLFKNHKKQSLIADRVFQLFDLKRDGGIEFEEFVRSLSIFHPEAPHAEKVSFAFQLFDVSQTGFIEREEVKGVILTLLVKEMILALLKESDLILSDDIIEAIINKAFEDADFKGDGKIDPEEWKEFVARNPSLLKNMTIPYLKDITTAFPSFVLRPDIEDDINSFL
cccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccHHHHHHHHHccccccccEEHHHHHHHHcHccccccHHHHHHHcEEcECccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHcccccccccccccccccccccccccHHcccc
***********SVNHAALAAQTHFKETEIEILYLLFKKLSSSLVDDGIISKEEFQLGLFKNHKKQSLIADRVFQLFDLKRDGGIEFEEFVRSLSIFHPEAPHAEKVSFAFQLFDVSQTGFIEREEVKGVILTLLVKEMILALLKESDLILSDDIIEAIINKAFEDADFKGDGKIDPEEWKEFVARNPSLLKNMTIPYLKDITTAFPSFVLRPDIE*****FL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCVCMKQRLKSVNHAALAAQTHFKETEIEILYLLFKKLSSSLVDDGIISKEEFQLGLFKNHKKQSLIADRVFQLFDLKRDGGIEFEEFVRSLSIFHPEAPHAEKVSFAFQLFDVSQTGFIEREEVKGVILTLLVKEMILALLKESDLILSDDIIEAIINKAFEDADFKGDGKIDPEEWKEFVARNPSLLKNMTIPYLKDITTAFPSFVLRPDIEDDINSFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcineurin B-like protein 4 Acts as a calcium sensor involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance. Operates in synergy with CIPK24/SOS2 to activate the plasma membrane Na(+)/H(+) antiporter SOS1. May function as positive regulator of salt stress responses. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableO81223
Calcineurin B-like protein 7 Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ3HRP0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EHB, chain A
Confidence level:very confident
Coverage over the Query: 14-204
View the alignment between query and template
View the model in PyMOL