BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041667
         (659 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ISL|A Chain A, Crystal Structure Of Ureidoglycine-Glyoxylate
           Aminotransferase (Pucg) From Bacillus Subtilis
 pdb|3ISL|B Chain B, Crystal Structure Of Ureidoglycine-Glyoxylate
           Aminotransferase (Pucg) From Bacillus Subtilis
          Length = 416

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 506 NPRDELLRRVKGLSPSVVTLVEQETNTNTAPFMARVNEACAYYGALFDSIESTVLRDHSD 565
           +P D ++R +K + P +V +V  ET+T     +  + EAC    ALF  I   V      
Sbjct: 124 DPED-IIREIKKVKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALF--IVDAVATIGGC 180

Query: 566 RVKVEE 571
            VKV+E
Sbjct: 181 EVKVDE 186


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,714,783
Number of Sequences: 62578
Number of extensions: 497115
Number of successful extensions: 1216
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1214
Number of HSP's gapped (non-prelim): 2
length of query: 659
length of database: 14,973,337
effective HSP length: 105
effective length of query: 554
effective length of database: 8,402,647
effective search space: 4655066438
effective search space used: 4655066438
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)