Query         041668
Match_columns 238
No_of_seqs    163 out of 702
Neff          5.2 
Searched_HMMs 46136
Date          Fri Mar 29 09:29:18 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041668.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041668hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02629 powdery mildew resist 100.0 2.4E-67 5.2E-72  493.8  17.2  169   63-238    48-217 (387)
  2 PF14416 PMR5N:  PMR5 N termina  99.9 3.7E-28   8E-33  171.8   4.8   55   65-120     1-55  (55)
  3 PF13839 PC-Esterase:  GDSL/SGN  99.9 8.6E-24 1.9E-28  183.2   8.8  102  121-238     1-112 (263)
  4 cd01842 SGNH_hydrolase_like_5   96.5  0.0026 5.6E-08   55.3   3.4   22  138-159     2-23  (183)
  5 cd01834 SGNH_hydrolase_like_2   77.1     1.2 2.6E-05   36.1   1.2   15  135-149     1-15  (191)
  6 cd01829 SGNH_hydrolase_peri2 S  74.6     2.7 5.9E-05   34.8   2.7   21  137-157     1-21  (200)
  7 cd01841 NnaC_like NnaC (CMP-Ne  71.4       2 4.4E-05   34.8   1.2   14  136-149     1-14  (174)
  8 COG2845 Uncharacterized protei  61.9     6.7 0.00015   37.4   2.7   31  129-159   110-140 (354)
  9 cd01825 SGNH_hydrolase_peri1 S  60.9     3.5 7.6E-05   33.5   0.6   17  137-153     1-18  (189)
 10 cd01844 SGNH_hydrolase_like_6   57.7     5.2 0.00011   32.9   1.1   13  137-149     1-13  (177)
 11 PF00185 OTCace:  Aspartate/orn  57.2     6.7 0.00015   32.7   1.7   25  134-159     1-25  (158)
 12 PF12026 DUF3513:  Domain of un  55.8     1.1 2.4E-05   39.9  -3.4   18  132-149   131-148 (210)
 13 cd01838 Isoamyl_acetate_hydrol  53.5     5.8 0.00013   32.2   0.7   13  137-149     1-13  (199)
 14 cd01835 SGNH_hydrolase_like_3   53.3     5.8 0.00013   32.7   0.7   13  136-148     2-14  (193)
 15 cd01832 SGNH_hydrolase_like_1   53.2     6.3 0.00014   32.0   0.9   11  137-147     1-11  (185)
 16 cd01827 sialate_O-acetylestera  47.7     8.3 0.00018   31.5   0.8   13  137-149     2-14  (188)
 17 cd01833 XynB_like SGNH_hydrola  47.5     6.7 0.00015   31.2   0.2   12  137-148     2-13  (157)
 18 cd01831 Endoglucanase_E_like E  46.8       9  0.0002   31.2   0.9   14  137-150     1-14  (169)
 19 cd01822 Lysophospholipase_L1_l  46.5     8.6 0.00019   30.8   0.7   12  137-148     2-13  (177)
 20 cd01820 PAF_acetylesterase_lik  46.1      11 0.00024   32.0   1.3   17  133-149    30-46  (214)
 21 PRK10528 multifunctional acyl-  44.2      12 0.00025   31.5   1.2   15  135-149    10-24  (191)
 22 PRK14805 ornithine carbamoyltr  40.6      16 0.00035   33.9   1.6   26  132-159   144-169 (302)
 23 cd00229 SGNH_hydrolase SGNH_hy  40.2      10 0.00022   28.9   0.2   15  138-152     1-15  (187)
 24 PF09949 DUF2183:  Uncharacteri  39.3      23 0.00049   27.8   2.0   23  126-148    55-77  (100)
 25 cd01836 FeeA_FeeB_like SGNH_hy  38.0      14 0.00031   30.2   0.8   14  136-149     3-16  (191)
 26 cd01830 XynE_like SGNH_hydrola  37.7      15 0.00033   30.8   0.9   12  137-148     1-12  (204)
 27 cd01839 SGNH_arylesterase_like  37.3      15 0.00033   30.7   0.9   12  137-148     1-12  (208)
 28 cd04501 SGNH_hydrolase_like_4   37.3      15 0.00033   29.8   0.8   12  136-147     1-12  (183)
 29 cd01828 sialate_O-acetylestera  36.7      16 0.00035   29.3   0.9   13  138-150     2-14  (169)
 30 PF11119 DUF2633:  Protein of u  34.2      39 0.00085   24.5   2.4   22    1-22      1-22  (59)
 31 cd04502 SGNH_hydrolase_like_7   32.2      21 0.00045   28.8   0.8   12  138-149     2-13  (171)
 32 PRK04284 ornithine carbamoyltr  32.0      28 0.00061   32.8   1.8   27  132-159   152-178 (332)
 33 PF13472 Lipase_GDSL_2:  GDSL-l  31.4      25 0.00053   27.2   1.1   12  139-150     1-12  (179)
 34 PF12729 4HB_MCP_1:  Four helix  30.7      53  0.0012   25.6   3.0   27    1-27      2-28  (181)
 35 cd01821 Rhamnogalacturan_acety  30.5      22 0.00047   29.5   0.7   14  137-150     2-15  (198)
 36 PF06072 Herpes_US9:  Alphaherp  30.1      45 0.00098   24.2   2.1   28    3-30     27-54  (60)
 37 cd01840 SGNH_hydrolase_yrhL_li  29.7      26 0.00057   28.1   1.0   18  138-155     2-19  (150)
 38 PF00702 Hydrolase:  haloacid d  27.5      44 0.00096   27.4   2.0   20  127-146   185-206 (215)
 39 PRK02102 ornithine carbamoyltr  27.2      40 0.00086   31.9   1.9   27  132-159   152-178 (331)
 40 PF14647 FAM91_N:  FAM91 N-term  27.2      58  0.0013   30.8   2.9   30  121-160   109-138 (308)
 41 PLN02342 ornithine carbamoyltr  27.2      41 0.00089   32.0   2.0   26  132-159   191-216 (348)
 42 TIGR01489 DKMTPPase-SF 2,3-dik  27.1      60  0.0013   26.1   2.8   13  135-147   162-174 (188)
 43 cd04506 SGNH_hydrolase_YpmR_li  27.0      29 0.00062   28.8   0.8   12  137-148     1-12  (204)
 44 PRK00856 pyrB aspartate carbam  26.8      38 0.00083   31.5   1.7   28  132-159   153-180 (305)
 45 COG0078 ArgF Ornithine carbamo  26.3      44 0.00094   31.6   1.9   21  133-155   151-171 (310)
 46 PLN02527 aspartate carbamoyltr  25.5      44 0.00096   31.0   1.8   27  132-158   148-174 (306)
 47 PRK13159 cytochrome c-type bio  24.8      74  0.0016   27.2   2.9   18    2-19      4-21  (155)
 48 PRK03515 ornithine carbamoyltr  24.7      44 0.00096   31.6   1.7   26  133-159   154-179 (336)
 49 PF01861 DUF43:  Protein of unk  24.1      34 0.00073   31.3   0.7   12  133-144    43-54  (243)
 50 PRK13150 cytochrome c-type bio  23.6      83  0.0018   27.0   3.0   26    2-30      4-29  (159)
 51 PRK01713 ornithine carbamoyltr  23.6      50  0.0011   31.1   1.9   26  133-159   154-179 (334)
 52 PRK10113 cell division modulat  23.1      39 0.00084   25.4   0.8   18  131-148    37-56  (80)
 53 PRK08192 aspartate carbamoyltr  22.2      53  0.0012   31.0   1.7   26  133-158   157-182 (338)
 54 TIGR00670 asp_carb_tr aspartat  21.3      58  0.0013   30.2   1.8   29  131-159   146-174 (301)
 55 PRK13165 cytochrome c-type bio  20.4 1.1E+02  0.0025   26.2   3.2   12    2-13      4-15  (160)
 56 PF07423 DUF1510:  Protein of u  20.2      92   0.002   27.9   2.7   33  108-152   124-157 (217)
 57 COG0034 PurF Glutamine phospho  20.1      51  0.0011   32.9   1.1   33  128-160   341-374 (470)
 58 PRK11891 aspartate carbamoyltr  20.1      67  0.0015   31.6   2.0   26  133-158   239-264 (429)

No 1  
>PLN02629 powdery mildew resistance 5
Probab=100.00  E-value=2.4e-67  Score=493.82  Aligned_cols=169  Identities=36%  Similarity=0.805  Sum_probs=157.7

Q ss_pred             CCCCCCcCcccceeeCCCCCCCCCCCCCC-CccCccccccCCCCCCcCceeeeeCCCCCCCCCChHHHHHHHcCCceEEe
Q 041668           63 QIGESCNVSGGKWIWDNKTYPVYTEESCP-YLSNQTCCQRNGRPDSFHQKWRWQPDGCNLPWFDPLKLLDILSGKRLMFI  141 (238)
Q Consensus        63 ~~~~~Cd~~~G~WV~d~~~~PlY~~~sCp-~i~~~~~C~~nGRpD~~y~~WrWqP~gC~Lprfd~~~fl~~lrgKrivFV  141 (238)
                      ...+.||+|+|+||+|+ ++|+|++.+|| ||++++||++|||||++|++|||||++|+||||||.+||++|||||||||
T Consensus        48 ~~~~~CD~f~G~WV~D~-s~PlY~~~~Cp~fi~~~~nC~knGRPD~~Yl~WRWqP~gC~LPRFda~~fLe~~RgKrl~FV  126 (387)
T PLN02629         48 ANQSTCALFVGTWVRDD-SYPLYQSSDCPGVIDPEFNCQMYGRPDSDYLKYRWQPLNCELPRFNGLEFLLKMKGKTVMFV  126 (387)
T ss_pred             CCccccCCCCCeEecCC-CCCCCCCCCCccccccccchhhcCCCCcchhhccccCCCCCCCCcCHHHHHHHhcCCeEEEe
Confidence            45688999999999996 67999999999 99999999999999999999999999999999999999999999999999


Q ss_pred             ehhhhHHHHHHHHhhhccccCCCceeeeeCCceeeEEecccceEEEEEEccceecccCCCCCcccceeeeEeeccccccc
Q 041668          142 GDSIQRGQFESMVCMVQSVIPEGKKSFQTIPTMEIFKAEEYNASIEFYWAPFIVESISDHATNHTVLKRLVYLDSITNQG  221 (238)
Q Consensus       142 GDSl~Rnq~~SL~ClL~~~~p~~~~~~~~~~~~~~~~f~~~n~tv~f~WsPfLv~~~~~~~~~~~~~~~~l~lD~i~~~~  221 (238)
                      ||||+|||||||+|||++++|..++.+.++++...|+|++||+||+||||||||+.+++.      ..++|+||++++++
T Consensus       127 GDSL~RNQ~eSLvClL~~~~p~~~~~~~~~~~~~~~~F~~yN~TV~~ywspfLV~~~~~~------~~~~l~LD~id~~a  200 (387)
T PLN02629        127 GDSLGRNQWESLICLISSSVPSTRTQMSRGDPLSTFKFLDYGVSISFYKAPYLVDIDAVQ------GKRVLKLEEISGNA  200 (387)
T ss_pred             ccccchhHHHHHHHHhhccCCCCceeeecCCceEEEEeccCCEEEEEEecceEEeeecCC------CceeEEecCcchhh
Confidence            999999999999999999998776666677788899999999999999999999987543      13579999999899


Q ss_pred             CCCCCCcEEEEcCCCCC
Q 041668          222 KSWQGVDMLVFESYAWW  238 (238)
Q Consensus       222 ~~w~~~DvLVfntGhWw  238 (238)
                      ++|+++|||||||||||
T Consensus       201 ~~w~~~DvlVfntghWw  217 (387)
T PLN02629        201 NAWRDADVLIFNTGHWW  217 (387)
T ss_pred             hhhccCCEEEEeCcccc
Confidence            99999999999999999


No 2  
>PF14416 PMR5N:  PMR5 N terminal Domain
Probab=99.94  E-value=3.7e-28  Score=171.83  Aligned_cols=55  Identities=47%  Similarity=1.182  Sum_probs=52.3

Q ss_pred             CCCCcCcccceeeCCCCCCCCCCCCCCCccCccccccCCCCCCcCceeeeeCCCCC
Q 041668           65 GESCNVSGGKWIWDNKTYPVYTEESCPYLSNQTCCQRNGRPDSFHQKWRWQPDGCN  120 (238)
Q Consensus        65 ~~~Cd~~~G~WV~d~~~~PlY~~~sCp~i~~~~~C~~nGRpD~~y~~WrWqP~gC~  120 (238)
                      +++||+|+|+||+|+ ++|+|++.+||||+++|||++|||||++|++|||||++|+
T Consensus         1 e~~Cd~~~G~WV~D~-~~PlY~~~~Cp~i~~~~nC~~nGRpD~~y~~wRWqP~~Cd   55 (55)
T PF14416_consen    1 EKRCDYFDGRWVPDP-SYPLYTNSTCPFIDEGFNCQKNGRPDSDYLKWRWQPRGCD   55 (55)
T ss_pred             CCccCcccCEEEeCC-CCCccCCCCCCcCCCccchhhcCCCCCccceeeecCCCCC
Confidence            468999999999997 5699999999999999999999999999999999999996


No 3  
>PF13839 PC-Esterase:  GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p
Probab=99.90  E-value=8.6e-24  Score=183.24  Aligned_cols=102  Identities=36%  Similarity=0.709  Sum_probs=82.0

Q ss_pred             CCCCChHHHHHHHcCCceEEeehhhhHHHHHHHHhhhccccC-----CCceeeeeCCceeeEEecccceEEEEEEcccee
Q 041668          121 LPWFDPLKLLDILSGKRLMFIGDSIQRGQFESMVCMVQSVIP-----EGKKSFQTIPTMEIFKAEEYNASIEFYWAPFIV  195 (238)
Q Consensus       121 Lprfd~~~fl~~lrgKrivFVGDSl~Rnq~~SL~ClL~~~~p-----~~~~~~~~~~~~~~~~f~~~n~tv~f~WsPfLv  195 (238)
                      |++||+.++|++||||+|+|||||++||+|+||+|+|.+..+     +........+....+.+.++|++|+|+|+|||+
T Consensus         1 ~~~~d~~~cL~~lr~k~i~fiGDS~~Rq~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~p~l~   80 (263)
T PF13839_consen    1 LPRFDARECLQRLRNKRIVFIGDSTTRQQYESLVCLLGPEVPSWQESPHSGIEFPNHRNFRYNFPDYNVTLSFYWDPFLV   80 (263)
T ss_pred             CChhhHHHHHHHccCCEEEEEechhhHHHHHHHHHHHhccccccccccccccccccCCceEEeecCCCeEEEEecccccc
Confidence            689999999999999999999999999999999999998776     222222333456678889999999999999999


Q ss_pred             cccCCCCCcccceeeeEeecccc-cccCCCC----CCcEEEEcCCCCC
Q 041668          196 ESISDHATNHTVLKRLVYLDSIT-NQGKSWQ----GVDMLVFESYAWW  238 (238)
Q Consensus       196 ~~~~~~~~~~~~~~~~l~lD~i~-~~~~~w~----~~DvLVfntGhWw  238 (238)
                      +.                +|.++ +....|.    .+||||+|+|+||
T Consensus        81 ~~----------------l~~~~~~~~~~~~~~~~~pdvvV~nsG~W~  112 (263)
T PF13839_consen   81 DQ----------------LDSIDEEIANNWPTSGARPDVVVINSGLWY  112 (263)
T ss_pred             cc----------------ccccchhhhccccccccCCCEEEEEcchhh
Confidence            75                22222 2344454    8999999999997


No 4  
>cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=96.47  E-value=0.0026  Score=55.28  Aligned_cols=22  Identities=36%  Similarity=0.758  Sum_probs=20.7

Q ss_pred             eEEeehhhhHHHHHHHHhhhcc
Q 041668          138 LMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       138 ivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      ++|+|||+.|-+|--|+|||+.
T Consensus         2 v~~lgds~~ravykdlv~l~q~   23 (183)
T cd01842           2 VVILGDSIQRAVYKDLVLLLQK   23 (183)
T ss_pred             EEEEccHHHHHHHHHHHHHhcC
Confidence            6899999999999999999984


No 5  
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=77.14  E-value=1.2  Score=36.09  Aligned_cols=15  Identities=47%  Similarity=0.886  Sum_probs=13.9

Q ss_pred             CCceEEeehhhhHHH
Q 041668          135 GKRLMFIGDSIQRGQ  149 (238)
Q Consensus       135 gKrivFVGDSl~Rnq  149 (238)
                      |++|+++|||++...
T Consensus         1 ~~~v~~~GDSit~g~   15 (191)
T cd01834           1 GDRIVFIGNSITDRG   15 (191)
T ss_pred             CCEEEEeCCChhhcc
Confidence            799999999999976


No 6  
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=74.58  E-value=2.7  Score=34.76  Aligned_cols=21  Identities=29%  Similarity=0.589  Sum_probs=17.2

Q ss_pred             ceEEeehhhhHHHHHHHHhhh
Q 041668          137 RLMFIGDSIQRGQFESMVCMV  157 (238)
Q Consensus       137 rivFVGDSl~Rnq~~SL~ClL  157 (238)
                      ||+|+|||++...+-++...+
T Consensus         1 ril~iGDS~~~g~~~~l~~~~   21 (200)
T cd01829           1 RVLVIGDSLAQGLAPGLLRAL   21 (200)
T ss_pred             CEEEEechHHHHHHHHHHHHh
Confidence            689999999999887766444


No 7  
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=71.43  E-value=2  Score=34.78  Aligned_cols=14  Identities=50%  Similarity=0.878  Sum_probs=12.0

Q ss_pred             CceEEeehhhhHHH
Q 041668          136 KRLMFIGDSIQRGQ  149 (238)
Q Consensus       136 KrivFVGDSl~Rnq  149 (238)
                      |+|+|+|||++..-
T Consensus         1 ~~iv~~GdS~t~~~   14 (174)
T cd01841           1 KNIVFIGDSLFEGW   14 (174)
T ss_pred             CCEEEEcchhhhcC
Confidence            68999999999753


No 8  
>COG2845 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=61.86  E-value=6.7  Score=37.40  Aligned_cols=31  Identities=16%  Similarity=0.314  Sum_probs=25.7

Q ss_pred             HHHHHcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          129 LLDILSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       129 fl~~lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      ..+.=.++++.|||||+++.+-+.|...|..
T Consensus       110 ~~k~~~a~kvLvvGDslm~gla~gl~~al~t  140 (354)
T COG2845         110 AAKSRDADKVLVVGDSLMQGLAEGLDKALAT  140 (354)
T ss_pred             hhhCCCCCEEEEechHHhhhhHHHHHHHhcc
Confidence            3444458999999999999999999888865


No 9  
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=60.91  E-value=3.5  Score=33.52  Aligned_cols=17  Identities=35%  Similarity=0.565  Sum_probs=12.4

Q ss_pred             ceEEeehhhhHH-HHHHH
Q 041668          137 RLMFIGDSIQRG-QFESM  153 (238)
Q Consensus       137 rivFVGDSl~Rn-q~~SL  153 (238)
                      ||+|+|||++-. .|-+.
T Consensus         1 ~iv~~GDS~t~g~~~~~~   18 (189)
T cd01825           1 RIAQLGDSHIAGDFFTDV   18 (189)
T ss_pred             CeeEecCccccccchhhH
Confidence            799999999963 34443


No 10 
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=57.72  E-value=5.2  Score=32.87  Aligned_cols=13  Identities=38%  Similarity=0.698  Sum_probs=11.3

Q ss_pred             ceEEeehhhhHHH
Q 041668          137 RLMFIGDSIQRGQ  149 (238)
Q Consensus       137 rivFVGDSl~Rnq  149 (238)
                      ||+|+|||++...
T Consensus         1 ~iv~~GDSit~G~   13 (177)
T cd01844           1 PWVFYGTSISQGA   13 (177)
T ss_pred             CEEEEeCchhcCc
Confidence            6899999998865


No 11 
>PF00185 OTCace:  Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain;  InterPro: IPR006131 This family contains two related enzymes:  Aspartate carbamoyltransferase (2.1.3.2 from EC) (ATCase) catalyzes the conversion of aspartate and carbamoyl phosphate to carbamoylaspartate, the second step in the de novo biosynthesis of pyrimidine nucleotides []. In prokaryotes ATCase consists of two subunits: a catalytic chain (gene pyrB) and a regulatory chain (gene pyrI), while in eukaryotes it is a domain in a multi- functional enzyme (called URA2 in yeast, rudimentary in Drosophila, and CAD in mammals []) that also catalyzes other steps of the biosynthesis of pyrimidines. Ornithine carbamoyltransferase (2.1.3.3 from EC) (OTCase) catalyzes the conversion of ornithine and carbamoyl phosphate to citrulline. In mammals this enzyme participates in the urea cycle [] and is located in the mitochondrial matrix. In prokaryotes and eukaryotic microorganisms it is involved in the biosynthesis of arginine. In some bacterial species it is also involved in the degradation of arginine [] (the arginine deaminase pathway).  It has been shown [] that these two enzymes are evolutionary related. The predicted secondary structure of both enzymes are similar and there are some regions of sequence similarities. One of these regions includes three residues which have been shown, by crystallographic studies [], to be implicated in binding the phosphoryl group of carbamoyl phosphate and is described by IPR006132 from INTERPRO. The carboxyl-terminal, aspartate/ornithine-binding domain is connected to the amino-terminal domain by two alpha-helices, which comprise a hinge between domains [].; GO: 0016597 amino acid binding, 0016743 carboxyl- or carbamoyltransferase activity, 0006520 cellular amino acid metabolic process; PDB: 1ML4_A 4EP1_B 3Q98_A 3E2P_A 2RGW_E 4EKN_B 2G7M_E 3D6N_B 3M4J_A 3L06_A ....
Probab=57.16  E-value=6.7  Score=32.71  Aligned_cols=25  Identities=16%  Similarity=0.416  Sum_probs=21.2

Q ss_pred             cCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          134 SGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       134 rgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      +|++|+|||| ..-|...|++.++..
T Consensus         1 ~gl~i~~vGD-~~~rv~~Sl~~~~~~   25 (158)
T PF00185_consen    1 KGLKIAYVGD-GHNRVAHSLIELLAK   25 (158)
T ss_dssp             TTEEEEEESS-TTSHHHHHHHHHHHH
T ss_pred             CCCEEEEECC-CCChHHHHHHHHHHH
Confidence            5899999999 667889999988874


No 12 
>PF12026 DUF3513:  Domain of unknown function (DUF3513);  InterPro: IPR021901  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 192 to 218 amino acids in length. This domain is found associated with PF00018 from PFAM, PF08824 from PFAM. This domain has a conserved QPP sequence motif. ; PDB: 3T6G_D 1X27_N.
Probab=55.81  E-value=1.1  Score=39.93  Aligned_cols=18  Identities=50%  Similarity=0.879  Sum_probs=14.5

Q ss_pred             HHcCCceEEeehhhhHHH
Q 041668          132 ILSGKRLMFIGDSIQRGQ  149 (238)
Q Consensus       132 ~lrgKrivFVGDSl~Rnq  149 (238)
                      +|-|.++|||||++.|+.
T Consensus       131 Il~ahkLVfiGDTl~r~~  148 (210)
T PF12026_consen  131 ILSAHKLVFIGDTLCREA  148 (210)
T ss_dssp             HHHHHHHHHHHHHHHHC-
T ss_pred             EEEeeeeeeeccHHHHHh
Confidence            455789999999999875


No 13 
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash.  The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=53.46  E-value=5.8  Score=32.25  Aligned_cols=13  Identities=31%  Similarity=0.618  Sum_probs=11.2

Q ss_pred             ceEEeehhhhHHH
Q 041668          137 RLMFIGDSIQRGQ  149 (238)
Q Consensus       137 rivFVGDSl~Rnq  149 (238)
                      ||+|+|||++...
T Consensus         1 ~i~~~GDSit~g~   13 (199)
T cd01838           1 KIVLFGDSITQFS   13 (199)
T ss_pred             CEEEecCcccccc
Confidence            6899999999863


No 14 
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=53.32  E-value=5.8  Score=32.74  Aligned_cols=13  Identities=54%  Similarity=0.953  Sum_probs=11.6

Q ss_pred             CceEEeehhhhHH
Q 041668          136 KRLMFIGDSIQRG  148 (238)
Q Consensus       136 KrivFVGDSl~Rn  148 (238)
                      ++|+|+|||++..
T Consensus         2 ~~i~~lGDSit~G   14 (193)
T cd01835           2 KRLIVVGDSLVYG   14 (193)
T ss_pred             cEEEEEcCccccC
Confidence            6899999999975


No 15 
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=53.17  E-value=6.3  Score=32.04  Aligned_cols=11  Identities=45%  Similarity=0.748  Sum_probs=10.0

Q ss_pred             ceEEeehhhhH
Q 041668          137 RLMFIGDSIQR  147 (238)
Q Consensus       137 rivFVGDSl~R  147 (238)
                      ||+|+|||++.
T Consensus         1 ~i~~~GDSit~   11 (185)
T cd01832           1 RYVALGDSITE   11 (185)
T ss_pred             CeeEecchhhc
Confidence            69999999996


No 16 
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=47.71  E-value=8.3  Score=31.51  Aligned_cols=13  Identities=31%  Similarity=0.715  Sum_probs=10.5

Q ss_pred             ceEEeehhhhHHH
Q 041668          137 RLMFIGDSIQRGQ  149 (238)
Q Consensus       137 rivFVGDSl~Rnq  149 (238)
                      ||+|+|||++-..
T Consensus         2 ~i~~~GDSit~G~   14 (188)
T cd01827           2 KVACVGNSITEGA   14 (188)
T ss_pred             eEEEEeccccccc
Confidence            6999999996543


No 17 
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=47.46  E-value=6.7  Score=31.15  Aligned_cols=12  Identities=58%  Similarity=0.925  Sum_probs=10.0

Q ss_pred             ceEEeehhhhHH
Q 041668          137 RLMFIGDSIQRG  148 (238)
Q Consensus       137 rivFVGDSl~Rn  148 (238)
                      +|++||||++-.
T Consensus         2 ~~~~~Gds~~~g   13 (157)
T cd01833           2 RIMPLGDSITWG   13 (157)
T ss_pred             ceeecCCceeec
Confidence            689999998755


No 18 
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=46.84  E-value=9  Score=31.16  Aligned_cols=14  Identities=50%  Similarity=0.702  Sum_probs=11.3

Q ss_pred             ceEEeehhhhHHHH
Q 041668          137 RLMFIGDSIQRGQF  150 (238)
Q Consensus       137 rivFVGDSl~Rnq~  150 (238)
                      +|+|+|||++-...
T Consensus         1 ~i~~iGDSit~G~~   14 (169)
T cd01831           1 KIEFIGDSITCGYG   14 (169)
T ss_pred             CEEEEeccccccCc
Confidence            58999999987543


No 19 
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=46.46  E-value=8.6  Score=30.84  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=10.2

Q ss_pred             ceEEeehhhhHH
Q 041668          137 RLMFIGDSIQRG  148 (238)
Q Consensus       137 rivFVGDSl~Rn  148 (238)
                      +|+|+|||++-.
T Consensus         2 ~i~~~GDSit~G   13 (177)
T cd01822           2 TILALGDSLTAG   13 (177)
T ss_pred             eEEEEccccccC
Confidence            699999999744


No 20 
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues.  In addition,  PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=46.12  E-value=11  Score=32.01  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=13.6

Q ss_pred             HcCCceEEeehhhhHHH
Q 041668          133 LSGKRLMFIGDSIQRGQ  149 (238)
Q Consensus       133 lrgKrivFVGDSl~Rnq  149 (238)
                      ....+|+|+|||++...
T Consensus        30 ~~~~~iv~lGDSit~g~   46 (214)
T cd01820          30 QKEPDVVFIGDSITQNW   46 (214)
T ss_pred             cCCCCEEEECchHhhhh
Confidence            34567999999999864


No 21 
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=44.17  E-value=12  Score=31.52  Aligned_cols=15  Identities=33%  Similarity=0.716  Sum_probs=12.8

Q ss_pred             CCceEEeehhhhHHH
Q 041668          135 GKRLMFIGDSIQRGQ  149 (238)
Q Consensus       135 gKrivFVGDSl~Rnq  149 (238)
                      +.+|+|+|||++...
T Consensus        10 ~~~iv~~GDSit~G~   24 (191)
T PRK10528         10 ADTLLILGDSLSAGY   24 (191)
T ss_pred             CCEEEEEeCchhhcC
Confidence            679999999999663


No 22 
>PRK14805 ornithine carbamoyltransferase; Provisional
Probab=40.56  E-value=16  Score=33.90  Aligned_cols=26  Identities=19%  Similarity=0.276  Sum_probs=21.2

Q ss_pred             HHcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          132 ILSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       132 ~lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      .++|++|+||||.  .|...|++.++..
T Consensus       144 ~l~g~kva~vGD~--~~v~~S~~~~~~~  169 (302)
T PRK14805        144 DVSKVKLAYVGDG--NNVTHSLMYGAAI  169 (302)
T ss_pred             CcCCcEEEEEcCC--CccHHHHHHHHHH
Confidence            4678999999994  5788999888764


No 23 
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=40.25  E-value=10  Score=28.92  Aligned_cols=15  Identities=47%  Similarity=0.634  Sum_probs=11.7

Q ss_pred             eEEeehhhhHHHHHH
Q 041668          138 LMFIGDSIQRGQFES  152 (238)
Q Consensus       138 ivFVGDSl~Rnq~~S  152 (238)
                      |+|+|||++......
T Consensus         1 i~~~GDS~~~g~~~~   15 (187)
T cd00229           1 ILVIGDSITAGYGAS   15 (187)
T ss_pred             CeeeccccccccCCC
Confidence            689999999876433


No 24 
>PF09949 DUF2183:  Uncharacterized conserved protein (DUF2183);  InterPro: IPR019236  This domain, found in various bacterial and fungal proteins, has no known function. 
Probab=39.30  E-value=23  Score=27.82  Aligned_cols=23  Identities=26%  Similarity=0.434  Sum_probs=18.7

Q ss_pred             hHHHHHHHcCCceEEeehhhhHH
Q 041668          126 PLKLLDILSGKRLMFIGDSIQRG  148 (238)
Q Consensus       126 ~~~fl~~lrgKrivFVGDSl~Rn  148 (238)
                      -.++++..-++++++||||-..-
T Consensus        55 i~~i~~~fP~~kfiLIGDsgq~D   77 (100)
T PF09949_consen   55 IERILRDFPERKFILIGDSGQHD   77 (100)
T ss_pred             HHHHHHHCCCCcEEEEeeCCCcC
Confidence            44677777899999999998764


No 25 
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=37.97  E-value=14  Score=30.24  Aligned_cols=14  Identities=43%  Similarity=0.703  Sum_probs=11.6

Q ss_pred             CceEEeehhhhHHH
Q 041668          136 KRLMFIGDSIQRGQ  149 (238)
Q Consensus       136 KrivFVGDSl~Rnq  149 (238)
                      .|++|+|||++-..
T Consensus         3 ~~i~~~GDSit~G~   16 (191)
T cd01836           3 LRLLVLGDSTAAGV   16 (191)
T ss_pred             eEEEEEeccccccc
Confidence            47999999999763


No 26 
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=37.70  E-value=15  Score=30.85  Aligned_cols=12  Identities=42%  Similarity=0.764  Sum_probs=10.2

Q ss_pred             ceEEeehhhhHH
Q 041668          137 RLMFIGDSIQRG  148 (238)
Q Consensus       137 rivFVGDSl~Rn  148 (238)
                      +|+|+|||++-.
T Consensus         1 ~iv~~GDSiT~G   12 (204)
T cd01830           1 SVVALGDSITDG   12 (204)
T ss_pred             CEEEEecccccC
Confidence            489999999964


No 27 
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=37.33  E-value=15  Score=30.70  Aligned_cols=12  Identities=33%  Similarity=0.592  Sum_probs=10.2

Q ss_pred             ceEEeehhhhHH
Q 041668          137 RLMFIGDSIQRG  148 (238)
Q Consensus       137 rivFVGDSl~Rn  148 (238)
                      +|+|+|||++..
T Consensus         1 ~I~~~GDSiT~G   12 (208)
T cd01839           1 TILCFGDSNTWG   12 (208)
T ss_pred             CEEEEecCcccC
Confidence            689999999854


No 28 
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=37.31  E-value=15  Score=29.82  Aligned_cols=12  Identities=42%  Similarity=0.678  Sum_probs=10.4

Q ss_pred             CceEEeehhhhH
Q 041668          136 KRLMFIGDSIQR  147 (238)
Q Consensus       136 KrivFVGDSl~R  147 (238)
                      .||+|+|||++.
T Consensus         1 ~~i~~~GDSi~~   12 (183)
T cd04501           1 MRVVCLGDSITY   12 (183)
T ss_pred             CeEEEEcccccc
Confidence            379999999986


No 29 
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=36.70  E-value=16  Score=29.33  Aligned_cols=13  Identities=46%  Similarity=0.869  Sum_probs=10.9

Q ss_pred             eEEeehhhhHHHH
Q 041668          138 LMFIGDSIQRGQF  150 (238)
Q Consensus       138 ivFVGDSl~Rnq~  150 (238)
                      |+|+|||+++..-
T Consensus         2 v~~~GdSi~~~~~   14 (169)
T cd01828           2 LVFLGDSLTEGGP   14 (169)
T ss_pred             EEEecchhhccCc
Confidence            7899999998753


No 30 
>PF11119 DUF2633:  Protein of unknown function (DUF2633);  InterPro: IPR022576  This family is conserved largely in Proteobacteria. Several members are named as YfgG. The function is not known. 
Probab=34.23  E-value=39  Score=24.47  Aligned_cols=22  Identities=23%  Similarity=0.232  Sum_probs=18.1

Q ss_pred             CcchhhhHHHHHHHHHHHHHHH
Q 041668            1 MRRRTTVQSLITVATALLLIVG   22 (238)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~   22 (238)
                      ||||+.+|..--|+|.+|+++=
T Consensus         1 ~r~k~~~~mtriVLLISfiIlf   22 (59)
T PF11119_consen    1 MRRKKNSRMTRIVLLISFIILF   22 (59)
T ss_pred             CCCcccchHHHHHHHHHHHHHH
Confidence            7888888888888888888764


No 31 
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=32.18  E-value=21  Score=28.83  Aligned_cols=12  Identities=33%  Similarity=0.420  Sum_probs=10.4

Q ss_pred             eEEeehhhhHHH
Q 041668          138 LMFIGDSIQRGQ  149 (238)
Q Consensus       138 ivFVGDSl~Rnq  149 (238)
                      |+|||||+.+.-
T Consensus         2 i~~~g~s~~~~w   13 (171)
T cd04502           2 ILFYGSSSIRLW   13 (171)
T ss_pred             EEEEcCchhcch
Confidence            799999998865


No 32 
>PRK04284 ornithine carbamoyltransferase; Provisional
Probab=32.03  E-value=28  Score=32.79  Aligned_cols=27  Identities=7%  Similarity=0.162  Sum_probs=21.3

Q ss_pred             HHcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          132 ILSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       132 ~lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      .++|++|+||||..+ |...|++-++..
T Consensus       152 ~l~g~kia~vGD~~~-~v~~Sl~~~~~~  178 (332)
T PRK04284        152 PYKDIKFTYVGDGRN-NVANALMQGAAI  178 (332)
T ss_pred             CcCCcEEEEecCCCc-chHHHHHHHHHH
Confidence            367899999999755 578888887763


No 33 
>PF13472 Lipase_GDSL_2:  GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A ....
Probab=31.40  E-value=25  Score=27.25  Aligned_cols=12  Identities=50%  Similarity=0.778  Sum_probs=9.7

Q ss_pred             EEeehhhhHHHH
Q 041668          139 MFIGDSIQRGQF  150 (238)
Q Consensus       139 vFVGDSl~Rnq~  150 (238)
                      +|+|||++-...
T Consensus         1 v~~GDS~t~g~~   12 (179)
T PF13472_consen    1 VFLGDSITAGYG   12 (179)
T ss_dssp             EEEESHHHHTTT
T ss_pred             CEEccccccCCC
Confidence            699999997643


No 34 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=30.65  E-value=53  Score=25.59  Aligned_cols=27  Identities=30%  Similarity=0.278  Sum_probs=22.1

Q ss_pred             CcchhhhHHHHHHHHHHHHHHHhhhhh
Q 041668            1 MRRRTTVQSLITVATALLLIVGTARSL   27 (238)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   27 (238)
                      |.=+++|-..|.+++++++++|.+.+.
T Consensus         2 l~I~~KL~~~f~~~~~l~~~~~~~~~~   28 (181)
T PF12729_consen    2 LSIRTKLILGFGLIILLLLIVGIVGLY   28 (181)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445788999999999999999988744


No 35 
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=30.50  E-value=22  Score=29.52  Aligned_cols=14  Identities=21%  Similarity=0.242  Sum_probs=11.6

Q ss_pred             ceEEeehhhhHHHH
Q 041668          137 RLMFIGDSIQRGQF  150 (238)
Q Consensus       137 rivFVGDSl~Rnq~  150 (238)
                      +|+|+|||++....
T Consensus         2 ~i~~~GDS~t~G~~   15 (198)
T cd01821           2 TIFLAGDSTVADYD   15 (198)
T ss_pred             EEEEEecCCcccCC
Confidence            68999999987653


No 36 
>PF06072 Herpes_US9:  Alphaherpesvirus tegument protein US9;  InterPro: IPR009278 This family consists of several US9 and related proteins from the Alphaherpesviruses. The function of the US9 protein is unknown although in Bovine herpesvirus 5 Us9 is essential for the anterograde spread of the virus from the olfactory mucosa to the bulb [].; GO: 0019033 viral tegument
Probab=30.12  E-value=45  Score=24.23  Aligned_cols=28  Identities=14%  Similarity=0.055  Sum_probs=13.7

Q ss_pred             chhhhHHHHHHHHHHHHHHHhhhhhccc
Q 041668            3 RRTTVQSLITVATALLLIVGTARSLLDN   30 (238)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~   30 (238)
                      ||+|.-.+.-..+..+++++.+++.|-.
T Consensus        27 ~RrRrc~~~v~~v~~~~~~c~~S~~lG~   54 (60)
T PF06072_consen   27 RRRRRCRLAVAIVFAVVALCVLSGGLGA   54 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4444444333334444466666665544


No 37 
>cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Most members of this sub-family appear to co-occur with N-terminal acyltransferase domains. Might be involved in lipid metabolism.
Probab=29.70  E-value=26  Score=28.10  Aligned_cols=18  Identities=22%  Similarity=0.255  Sum_probs=12.5

Q ss_pred             eEEeehhhhHHHHHHHHh
Q 041668          138 LMFIGDSIQRGQFESMVC  155 (238)
Q Consensus       138 ivFVGDSl~Rnq~~SL~C  155 (238)
                      |.|+|||++-..-..|-.
T Consensus         2 v~~~GDSv~~~~~~~~~~   19 (150)
T cd01840           2 ITAIGDSVMLDSSPALQE   19 (150)
T ss_pred             eeEEeehHHHchHHHHHH
Confidence            689999998865444333


No 38 
>PF00702 Hydrolase:  haloacid dehalogenase-like hydrolase;  InterPro: IPR005834  This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase). This group includes L-2-haloacid dehalogenase, epoxide hydrolases and phosphatases. The structure consists of two domains. One is an inserted four helix bundle, which is the least well conserved region of the alignment, between residues 16 and 96 of HAD1_PSESP. The rest of the fold is composed of the core alpha/beta domain.; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 1TE2_A 3NAL_A 3NAM_A 3NAN_A 3A1D_B 3J09_A 3J08_A 2B8E_C 3A1E_A 2VOY_J ....
Probab=27.54  E-value=44  Score=27.35  Aligned_cols=20  Identities=20%  Similarity=0.556  Sum_probs=15.6

Q ss_pred             HHHHHHHc--CCceEEeehhhh
Q 041668          127 LKLLDILS--GKRLMFIGDSIQ  146 (238)
Q Consensus       127 ~~fl~~lr--gKrivFVGDSl~  146 (238)
                      ..+++.|+  +..+++|||+++
T Consensus       185 ~~~i~~l~~~~~~v~~vGDg~n  206 (215)
T PF00702_consen  185 LRIIKELQVKPGEVAMVGDGVN  206 (215)
T ss_dssp             HHHHHHHTCTGGGEEEEESSGG
T ss_pred             HHHHHHHhcCCCEEEEEccCHH
Confidence            46677776  568999999983


No 39 
>PRK02102 ornithine carbamoyltransferase; Validated
Probab=27.24  E-value=40  Score=31.86  Aligned_cols=27  Identities=22%  Similarity=0.346  Sum_probs=21.3

Q ss_pred             HHcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          132 ILSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       132 ~lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      .++|++|+||||..+ |...|++.++..
T Consensus       152 ~l~g~~va~vGd~~~-~v~~Sl~~~~~~  178 (331)
T PRK02102        152 PLKGLKLAYVGDGRN-NMANSLMVGGAK  178 (331)
T ss_pred             CCCCCEEEEECCCcc-cHHHHHHHHHHH
Confidence            367899999999864 488888887653


No 40 
>PF14647 FAM91_N:  FAM91 N-terminus
Probab=27.17  E-value=58  Score=30.77  Aligned_cols=30  Identities=30%  Similarity=0.455  Sum_probs=25.3

Q ss_pred             CCCCChHHHHHHHcCCceEEeehhhhHHHHHHHHhhhccc
Q 041668          121 LPWFDPLKLLDILSGKRLMFIGDSIQRGQFESMVCMVQSV  160 (238)
Q Consensus       121 Lprfd~~~fl~~lrgKrivFVGDSl~Rnq~~SL~ClL~~~  160 (238)
                      ||.|+|+|.|+++.          ++||||-.|+.-..+.
T Consensus       109 LPNFTAaD~LRllG----------IGRNqYIdlmn~~RS~  138 (308)
T PF14647_consen  109 LPNFTAADCLRLLG----------IGRNQYIDLMNKCRSK  138 (308)
T ss_pred             CCCCcHHHHHHHhc----------chHHHHHHHHHHhchh
Confidence            99999999998874          7899999998766553


No 41 
>PLN02342 ornithine carbamoyltransferase
Probab=27.17  E-value=41  Score=32.03  Aligned_cols=26  Identities=19%  Similarity=0.475  Sum_probs=21.3

Q ss_pred             HHcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          132 ILSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       132 ~lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      .+.|++|+||||-  .|...|++.++..
T Consensus       191 ~l~glkva~vGD~--~nva~Sli~~~~~  216 (348)
T PLN02342        191 RLEGTKVVYVGDG--NNIVHSWLLLAAV  216 (348)
T ss_pred             CcCCCEEEEECCC--chhHHHHHHHHHH
Confidence            4679999999994  3699999988764


No 42 
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. Note that SP|P53981 from S. cerevisiae, a member of this family, is annotated as a "probable membrane protein" due to a predicted transmembrane helix. The region in question contains the second of the three conserved HAD superfamily catalytic motifs and thus, considering the fold of the HAD catalytic domain, is unlikely to be a transmembrane region in fact.
Probab=27.13  E-value=60  Score=26.12  Aligned_cols=13  Identities=23%  Similarity=0.692  Sum_probs=10.8

Q ss_pred             CCceEEeehhhhH
Q 041668          135 GKRLMFIGDSIQR  147 (238)
Q Consensus       135 gKrivFVGDSl~R  147 (238)
                      .+.++|||||.+=
T Consensus       162 ~~~~i~iGD~~~D  174 (188)
T TIGR01489       162 YQHIIYIGDGVTD  174 (188)
T ss_pred             CceEEEECCCcch
Confidence            5689999999864


No 43 
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=27.02  E-value=29  Score=28.83  Aligned_cols=12  Identities=33%  Similarity=0.858  Sum_probs=10.6

Q ss_pred             ceEEeehhhhHH
Q 041668          137 RLMFIGDSIQRG  148 (238)
Q Consensus       137 rivFVGDSl~Rn  148 (238)
                      +|+|+|||++..
T Consensus         1 ~i~~~GDSit~G   12 (204)
T cd04506           1 KIVALGDSLTEG   12 (204)
T ss_pred             CEeEEeccccCc
Confidence            489999999985


No 44 
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=26.77  E-value=38  Score=31.47  Aligned_cols=28  Identities=18%  Similarity=0.237  Sum_probs=21.7

Q ss_pred             HHcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          132 ILSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       132 ~lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      .++|++|+||||-..-|...|++-++..
T Consensus       153 ~l~g~kv~~vGD~~~~~v~~Sl~~~~~~  180 (305)
T PRK00856        153 RLEGLKVAIVGDIKHSRVARSNIQALTR  180 (305)
T ss_pred             CCCCCEEEEECCCCCCcHHHHHHHHHHH
Confidence            4689999999997655777887776653


No 45 
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism]
Probab=26.32  E-value=44  Score=31.62  Aligned_cols=21  Identities=29%  Similarity=0.597  Sum_probs=18.4

Q ss_pred             HcCCceEEeehhhhHHHHHHHHh
Q 041668          133 LSGKRLMFIGDSIQRGQFESMVC  155 (238)
Q Consensus       133 lrgKrivFVGDSl~Rnq~~SL~C  155 (238)
                      ++|++++||||-  -|+-.||+-
T Consensus       151 l~g~k~a~vGDg--NNv~nSl~~  171 (310)
T COG0078         151 LKGLKLAYVGDG--NNVANSLLL  171 (310)
T ss_pred             ccCcEEEEEcCc--chHHHHHHH
Confidence            689999999999  888888764


No 46 
>PLN02527 aspartate carbamoyltransferase
Probab=25.49  E-value=44  Score=31.04  Aligned_cols=27  Identities=19%  Similarity=0.363  Sum_probs=20.4

Q ss_pred             HHcCCceEEeehhhhHHHHHHHHhhhc
Q 041668          132 ILSGKRLMFIGDSIQRGQFESMVCMVQ  158 (238)
Q Consensus       132 ~lrgKrivFVGDSl~Rnq~~SL~ClL~  158 (238)
                      .++|++|+||||-.+-|...|++-++.
T Consensus       148 ~l~g~kva~vGD~~~~rv~~Sl~~~~~  174 (306)
T PLN02527        148 RLDGIKVGLVGDLANGRTVRSLAYLLA  174 (306)
T ss_pred             CcCCCEEEEECCCCCChhHHHHHHHHH
Confidence            367899999999865456777776654


No 47 
>PRK13159 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=24.82  E-value=74  Score=27.15  Aligned_cols=18  Identities=33%  Similarity=0.324  Sum_probs=9.7

Q ss_pred             cchhhhHHHHHHHHHHHH
Q 041668            2 RRRTTVQSLITVATALLL   19 (238)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~   19 (238)
                      +|++|+..|+.+++++.+
T Consensus         4 ~r~rRl~~v~~~~~~~~~   21 (155)
T PRK13159          4 TRKQRLWLVIGVLTAAAL   21 (155)
T ss_pred             hhhhHHHHHHHHHHHHHH
Confidence            567777655444443333


No 48 
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional
Probab=24.70  E-value=44  Score=31.58  Aligned_cols=26  Identities=15%  Similarity=0.192  Sum_probs=20.0

Q ss_pred             HcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          133 LSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       133 lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      ++|.+|+||||-.+ |...|++-++..
T Consensus       154 l~g~~ia~vGD~~~-~v~~Sl~~~~~~  179 (336)
T PRK03515        154 FNEMTLAYAGDARN-NMGNSLLEAAAL  179 (336)
T ss_pred             cCCCEEEEeCCCcC-cHHHHHHHHHHH
Confidence            56899999999434 588888877753


No 49 
>PF01861 DUF43:  Protein of unknown function DUF43;  InterPro: IPR002723 This family of prokaryotic proteins have not been characterised. All the members are 350-400 amino acids long.; PDB: 2QM3_A.
Probab=24.07  E-value=34  Score=31.27  Aligned_cols=12  Identities=58%  Similarity=1.273  Sum_probs=8.7

Q ss_pred             HcCCceEEeehh
Q 041668          133 LSGKRLMFIGDS  144 (238)
Q Consensus       133 lrgKrivFVGDS  144 (238)
                      |.||+|+||||=
T Consensus        43 L~gk~il~lGDD   54 (243)
T PF01861_consen   43 LEGKRILFLGDD   54 (243)
T ss_dssp             STT-EEEEES-T
T ss_pred             ccCCEEEEEcCC
Confidence            679999999994


No 50 
>PRK13150 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=23.62  E-value=83  Score=26.95  Aligned_cols=26  Identities=19%  Similarity=0.087  Sum_probs=12.7

Q ss_pred             cchhhhHHHHHHHHHHHHHHHhhhhhccc
Q 041668            2 RRRTTVQSLITVATALLLIVGTARSLLDN   30 (238)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   30 (238)
                      +|++|+..|+.++   +++..++.+++.+
T Consensus         4 ~r~rRl~~v~~~~---~~~~~a~~Lvl~a   29 (159)
T PRK13150          4 RRKNRLWVVCAVL---AGLGLTTALVLYA   29 (159)
T ss_pred             hhhhHHHHHHHHH---HHHHHHHHHHHHH
Confidence            5677775544333   3333344444444


No 51 
>PRK01713 ornithine carbamoyltransferase; Provisional
Probab=23.62  E-value=50  Score=31.08  Aligned_cols=26  Identities=23%  Similarity=0.309  Sum_probs=20.2

Q ss_pred             HcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          133 LSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       133 lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      +.|++|+||||-.+ |...|++.++..
T Consensus       154 l~gl~ia~vGD~~~-~v~~Sl~~~~~~  179 (334)
T PRK01713        154 LSEISYVYIGDARN-NMGNSLLLIGAK  179 (334)
T ss_pred             cCCcEEEEECCCcc-CHHHHHHHHHHH
Confidence            67899999999644 488888877653


No 52 
>PRK10113 cell division modulator; Provisional
Probab=23.15  E-value=39  Score=25.38  Aligned_cols=18  Identities=39%  Similarity=0.673  Sum_probs=13.5

Q ss_pred             HHHcCCceEEe--ehhhhHH
Q 041668          131 DILSGKRLMFI--GDSIQRG  148 (238)
Q Consensus       131 ~~lrgKrivFV--GDSl~Rn  148 (238)
                      =.||||.++||  |||.-|.
T Consensus        37 W~LrGKYVAFvl~ge~FrRS   56 (80)
T PRK10113         37 WMLRGKYVAFVLMGESFLRS   56 (80)
T ss_pred             heeccceEEEEEechhhccC
Confidence            35899999986  7776653


No 53 
>PRK08192 aspartate carbamoyltransferase; Provisional
Probab=22.24  E-value=53  Score=31.04  Aligned_cols=26  Identities=15%  Similarity=0.295  Sum_probs=20.0

Q ss_pred             HcCCceEEeehhhhHHHHHHHHhhhc
Q 041668          133 LSGKRLMFIGDSIQRGQFESMVCMVQ  158 (238)
Q Consensus       133 lrgKrivFVGDSl~Rnq~~SL~ClL~  158 (238)
                      ++|++|+||||-..-|...|++.+|.
T Consensus       157 l~g~kia~vGD~~~~rv~~Sl~~~l~  182 (338)
T PRK08192        157 IDGMHIAMVGDLKFGRTVHSLSRLLC  182 (338)
T ss_pred             cCCCEEEEECcCCCCchHHHHHHHHH
Confidence            67899999999754567778776654


No 54 
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase. Ornithine carbamoyltransferases are in the same superfamily and form an outgroup.
Probab=21.30  E-value=58  Score=30.22  Aligned_cols=29  Identities=17%  Similarity=0.272  Sum_probs=21.8

Q ss_pred             HHHcCCceEEeehhhhHHHHHHHHhhhcc
Q 041668          131 DILSGKRLMFIGDSIQRGQFESMVCMVQS  159 (238)
Q Consensus       131 ~~lrgKrivFVGDSl~Rnq~~SL~ClL~~  159 (238)
                      ..++|++|+||||-..-|...|++-++..
T Consensus       146 g~l~g~~va~vGD~~~~~v~~Sl~~~~a~  174 (301)
T TIGR00670       146 GRLDGLKIALVGDLKYGRTVHSLAEALTR  174 (301)
T ss_pred             CCCCCCEEEEEccCCCCcHHHHHHHHHHH
Confidence            34789999999997655777777776653


No 55 
>PRK13165 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=20.37  E-value=1.1e+02  Score=26.16  Aligned_cols=12  Identities=25%  Similarity=0.299  Sum_probs=6.4

Q ss_pred             cchhhhHHHHHH
Q 041668            2 RRRTTVQSLITV   13 (238)
Q Consensus         2 ~~~~~~~~~~~~   13 (238)
                      +|++|+..++.+
T Consensus         4 ~~~rRl~~~~~~   15 (160)
T PRK13165          4 RRKKRLWLACAV   15 (160)
T ss_pred             cchhhHHHHHHH
Confidence            566676544333


No 56 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=20.16  E-value=92  Score=27.92  Aligned_cols=33  Identities=15%  Similarity=0.370  Sum_probs=18.6

Q ss_pred             cCceeeeeCCCCCCCCCChHHHHHHHcCCc-eEEeehhhhHHHHHH
Q 041668          108 FHQKWRWQPDGCNLPWFDPLKLLDILSGKR-LMFIGDSIQRGQFES  152 (238)
Q Consensus       108 ~y~~WrWqP~gC~Lprfd~~~fl~~lrgKr-ivFVGDSl~Rnq~~S  152 (238)
                      .|.+=.|+|-|-.-            .|.+ .-|=-+|.-++-|..
T Consensus       124 ~~t~~~W~pvgT~Q------------~g~h~~~y~~~S~DW~Em~~  157 (217)
T PF07423_consen  124 TITNPSWKPVGTEQ------------TGEHVMTYDSGSVDWNEMLK  157 (217)
T ss_pred             ceeccCcccccccc------------CCCccccccCCCcCHHHHHH
Confidence            35555799976542            3343 335556666665544


No 57 
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=20.11  E-value=51  Score=32.86  Aligned_cols=33  Identities=30%  Similarity=0.600  Sum_probs=26.6

Q ss_pred             HHHHHHcCCceEEeehhhhHHH-HHHHHhhhccc
Q 041668          128 KLLDILSGKRLMFIGDSIQRGQ-FESMVCMVQSV  160 (238)
Q Consensus       128 ~fl~~lrgKrivFVGDSl~Rnq-~~SL~ClL~~~  160 (238)
                      ...+.++|||++.|=||+-|.- ..-++.||..+
T Consensus       341 pvr~~v~GKrVvlVDDSIVRGTTsr~IV~mlReA  374 (470)
T COG0034         341 PVREVVKGKRVVLVDDSIVRGTTSRRIVQMLREA  374 (470)
T ss_pred             chHHHhCCCeEEEEccccccCccHHHHHHHHHHh
Confidence            4677888999999999999864 66677777743


No 58 
>PRK11891 aspartate carbamoyltransferase; Provisional
Probab=20.11  E-value=67  Score=31.57  Aligned_cols=26  Identities=19%  Similarity=0.388  Sum_probs=20.1

Q ss_pred             HcCCceEEeehhhhHHHHHHHHhhhc
Q 041668          133 LSGKRLMFIGDSIQRGQFESMVCMVQ  158 (238)
Q Consensus       133 lrgKrivFVGDSl~Rnq~~SL~ClL~  158 (238)
                      ++|++|+||||-..-|...|++.++.
T Consensus       239 l~G~kIa~vGD~~~~rv~~Sl~~~la  264 (429)
T PRK11891        239 VDGAHIALVGDLKYGRTVHSLVKLLA  264 (429)
T ss_pred             cCCCEEEEECcCCCChHHHHHHHHHH
Confidence            57899999999754567788777653


Done!