Query         041672
Match_columns 127
No_of_seqs    117 out of 185
Neff          2.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:31:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041672.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041672hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04770 ZF-HD_dimer:  ZF-HD pr 100.0 1.7E-40 3.6E-45  224.4   3.8   58   11-68      2-60  (60)
  2 TIGR01566 ZF_HD_prot_N ZF-HD h 100.0 8.5E-40 1.8E-44  216.7   3.1   52   14-65      1-53  (53)
  3 PHA02893 hypothetical protein;  66.8     2.2 4.8E-05   31.3   0.4   21   36-56     57-77  (88)
  4 PF13698 DUF4156:  Domain of un  65.4     3.1 6.7E-05   29.4   0.9   15   18-32     53-67  (93)
  5 cd00029 C1 Protein kinase C co  51.4       7 0.00015   22.9   0.7   30   29-63     12-41  (50)
  6 smart00109 C1 Protein kinase C  45.1      14  0.0003   21.2   1.3   28   29-62     12-39  (49)
  7 PF05077 DUF678:  Protein of un  43.7     9.7 0.00021   27.2   0.5   11   46-56     55-65  (74)
  8 PF01485 IBR:  IBR domain;  Int  35.9      31 0.00068   20.8   1.9   30   33-62     25-60  (64)
  9 PF00130 C1_1:  Phorbol esters/  34.3      28 0.00061   21.0   1.5   23   30-55     13-35  (53)
 10 KOG0705 GTPase-activating prot  33.5      18 0.00038   34.8   0.7   36   28-64    514-550 (749)
 11 smart00661 RPOL9 RNA polymeras  29.7      40 0.00087   20.2   1.6   25   33-57      5-29  (52)
 12 PF01873 eIF-5_eIF-2B:  Domain   27.2      24 0.00051   26.4   0.3   14   45-58    111-124 (125)
 13 KOG2767 Translation initiation  26.6      20 0.00043   32.3  -0.2   17   48-64    118-134 (400)

No 1  
>PF04770 ZF-HD_dimer:  ZF-HD protein dimerisation region;  InterPro: IPR006456 The homeodomain (HD) is a 60-amino acid DNA-binding domain found in many transcription factors. HD-containing proteins are found in diverse organisms such as humans, Drosophila, nematode worms, and plants, where they play important roles in development. Zinc-finger-homeodomain (ZF- HD) subfamily proteins have only been identified in plants, and likely play plant specific roles. ZF-HD proteins are expressed predominantly or exclusively in floral tissue, indicating a likely regulatory role during floral development []. The ZF-HD class of homeodomain proteins may also be involved in the photosynthesis-related mesophyll-specific gene expression of phosphoenolpyruvate carboxylase in C4 species [] and in pathogen signaling and plant defense mechanisms [].  These proteins share three domains of high sequence similarity: the homeodomain (II) located at the carboxy-terminus, and two other segments (Ia and Ib) located in the amino-terminal part. These N-terminal domains contain five conserved cysteine residues and at least three conserved histidine residues whose spacing ressembles zinc-binding domains involved in dimerization of transcription factors. Although the two domains contain at least eight potential zinc-binding amino-acids, the unique spacing of the conserved cysteine and histidine residues within domain Ib suggests that both domains form one rather than two zinc finger structures. The two conserved motifs Ia and Ib constitute a dimerization domain which is sufficient for the formation of homo- and heterodimers [].  This entry represents the N-terminal Cysteine/Histidine-rich dimerization domain. The companion ZF-HD homeobox domain is described in IPR006455 from INTERPRO. 
Probab=100.00  E-value=1.7e-40  Score=224.41  Aligned_cols=58  Identities=76%  Similarity=1.422  Sum_probs=55.3

Q ss_pred             ceeehHHHhhhhhhhcCCccccCccccccC-CCCCCccccccccccccccccccccCCC
Q 041672           11 KVVRYKECLKNHAAAIGGSATDGCGEFMPS-GEEGSIESLKCSACNCHRNFHRKEIGCD   68 (127)
Q Consensus        11 ~~v~Y~EC~kNHAa~~GghavDGCgEFmps-g~~gt~~aL~CaACgCHRnFHRre~~~~   68 (127)
                      .+|+|+||||||||+||||+||||+||||+ +++|++++|+||||||||||||||++++
T Consensus         2 ~~v~Y~EC~kNHAa~~Gg~a~DGCgEFm~~~g~eg~~~al~CaACgCHRnFHRre~~~e   60 (60)
T PF04770_consen    2 KVVRYRECLKNHAASIGGHAVDGCGEFMPSPGEEGTPEALKCAACGCHRNFHRREVEGE   60 (60)
T ss_pred             CceeHHHHHhhHhHhhCCcccccccccccCCCCCCCcccceecccCcchhcccCCcCCC
Confidence            479999999999999999999999999999 8899999999999999999999998764


No 2  
>TIGR01566 ZF_HD_prot_N ZF-HD homeobox protein Cys/His-rich dimerization domain. This model describes a 54-residue domain found in the N-terminal region of plant proteins, the vast majority of which contain a ZF-HD class homeobox domain toward the C-terminus. The region between the two domains typically is rich in low complexity sequence. The companion ZF-HD homeobox domain is described in model TIGR01565.
Probab=100.00  E-value=8.5e-40  Score=216.67  Aligned_cols=52  Identities=81%  Similarity=1.421  Sum_probs=50.1

Q ss_pred             ehHHHhhhhhhhcCCccccCcccccc-CCCCCCcccccccccccccccccccc
Q 041672           14 RYKECLKNHAAAIGGSATDGCGEFMP-SGEEGSIESLKCSACNCHRNFHRKEI   65 (127)
Q Consensus        14 ~Y~EC~kNHAa~~GghavDGCgEFmp-sg~~gt~~aL~CaACgCHRnFHRre~   65 (127)
                      +|+||||||||+|||||||||+|||| +++++++++|+||||||||||||||+
T Consensus         1 ~Y~EC~kNHAa~~Gg~a~DGCgEFmps~g~~~~~~al~CaACgCHRnFHRre~   53 (53)
T TIGR01566         1 LYKECLKNHAASIGGHALDGCGEFMPSSGEEGDPESLTCAACGCHRNFHRKEP   53 (53)
T ss_pred             CHHHHHHhhHHHhCCcccccccccccCCCCCCCCcceeeeecCcccccccCCC
Confidence            69999999999999999999999999 68899999999999999999999985


No 3  
>PHA02893 hypothetical protein; Provisional
Probab=66.79  E-value=2.2  Score=31.32  Aligned_cols=21  Identities=29%  Similarity=0.653  Sum_probs=13.7

Q ss_pred             ccccCCCCCCccccccccccc
Q 041672           36 EFMPSGEEGSIESLKCSACNC   56 (127)
Q Consensus        36 EFmpsg~~gt~~aL~CaACgC   56 (127)
                      +|.+.|.-+....|.|+|||-
T Consensus        57 ~~~~~Gk~~~~~tL~CaACGS   77 (88)
T PHA02893         57 DYLNIGKAFSNSNIKCIACGS   77 (88)
T ss_pred             HHHhccccCCCCceeehhhch
Confidence            345554434446899999983


No 4  
>PF13698 DUF4156:  Domain of unknown function (DUF4156)
Probab=65.40  E-value=3.1  Score=29.40  Aligned_cols=15  Identities=40%  Similarity=0.594  Sum_probs=13.1

Q ss_pred             HhhhhhhhcCCcccc
Q 041672           18 CLKNHAAAIGGSATD   32 (127)
Q Consensus        18 C~kNHAa~~GghavD   32 (127)
                      =+||.||.+||.+|=
T Consensus        53 dlrNeAa~lGgntV~   67 (93)
T PF13698_consen   53 DLRNEAAKLGGNTVV   67 (93)
T ss_pred             HHHHHHHHhCCCEEE
Confidence            379999999998874


No 5  
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=51.35  E-value=7  Score=22.89  Aligned_cols=30  Identities=27%  Similarity=0.429  Sum_probs=20.6

Q ss_pred             ccccCccccccCCCCCCcccccccccccccccccc
Q 041672           29 SATDGCGEFMPSGEEGSIESLKCSACNCHRNFHRK   63 (127)
Q Consensus        29 havDGCgEFmpsg~~gt~~aL~CaACgCHRnFHRr   63 (127)
                      ..=+-|+++|.+.   ...+++|..|  ..+.|.+
T Consensus        12 ~~C~~C~~~i~~~---~~~~~~C~~C--~~~~H~~   41 (50)
T cd00029          12 TFCDVCRKSIWGL---FKQGLRCSWC--KVKCHKK   41 (50)
T ss_pred             CChhhcchhhhcc---ccceeEcCCC--CCchhhh
Confidence            3456799999874   3468999888  4455544


No 6  
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=45.08  E-value=14  Score=21.23  Aligned_cols=28  Identities=21%  Similarity=0.421  Sum_probs=19.3

Q ss_pred             ccccCccccccCCCCCCccccccccccccccccc
Q 041672           29 SATDGCGEFMPSGEEGSIESLKCSACNCHRNFHR   62 (127)
Q Consensus        29 havDGCgEFmpsg~~gt~~aL~CaACgCHRnFHR   62 (127)
                      ..=+-|+++|....    .+++|+.|+  ...|.
T Consensus        12 ~~C~~C~~~i~~~~----~~~~C~~C~--~~~H~   39 (49)
T smart00109       12 TKCCVCRKSIWGSF----QGLRCSWCK--VKCHK   39 (49)
T ss_pred             CCccccccccCcCC----CCcCCCCCC--chHHH
Confidence            34578999998643    479999874  44443


No 7  
>PF05077 DUF678:  Protein of unknown function (DUF678);  InterPro: IPR007769 This family contains poxvirus proteins belonging to the A19 family. The proteins are of unknown function.
Probab=43.70  E-value=9.7  Score=27.21  Aligned_cols=11  Identities=45%  Similarity=0.911  Sum_probs=8.9

Q ss_pred             ccccccccccc
Q 041672           46 IESLKCSACNC   56 (127)
Q Consensus        46 ~~aL~CaACgC   56 (127)
                      ...|.|+|||-
T Consensus        55 ~~tLsCsACGS   65 (74)
T PF05077_consen   55 GNTLSCSACGS   65 (74)
T ss_pred             CCeEeehhccc
Confidence            35799999983


No 8  
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=35.87  E-value=31  Score=20.84  Aligned_cols=30  Identities=17%  Similarity=0.605  Sum_probs=16.1

Q ss_pred             CccccccCCCCCCcccccccccc------ccccccc
Q 041672           33 GCGEFMPSGEEGSIESLKCSACN------CHRNFHR   62 (127)
Q Consensus        33 GCgEFmpsg~~gt~~aL~CaACg------CHRnFHR   62 (127)
                      +|..++...........+|.+|+      |.+.+|.
T Consensus        25 ~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~~H~   60 (64)
T PF01485_consen   25 DCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGEPWHE   60 (64)
T ss_dssp             ST---ECS-SSTTS--CCTTSCCSEECSSSTSESCT
T ss_pred             CCcccEEecCCCCCCeeECCCCCCcCccccCcccCC
Confidence            58888876543332248899886      6666665


No 9  
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=34.30  E-value=28  Score=21.00  Aligned_cols=23  Identities=30%  Similarity=0.632  Sum_probs=16.1

Q ss_pred             cccCccccccCCCCCCcccccccccc
Q 041672           30 ATDGCGEFMPSGEEGSIESLKCSACN   55 (127)
Q Consensus        30 avDGCgEFmpsg~~gt~~aL~CaACg   55 (127)
                      -=|-|+++|.+   ....+++|..|+
T Consensus        13 ~C~~C~~~i~g---~~~~g~~C~~C~   35 (53)
T PF00130_consen   13 YCDVCGKFIWG---LGKQGYRCSWCG   35 (53)
T ss_dssp             B-TTSSSBECS---SSSCEEEETTTT
T ss_pred             CCcccCcccCC---CCCCeEEECCCC
Confidence            34779999954   224689999775


No 10 
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]
Probab=33.51  E-value=18  Score=34.81  Aligned_cols=36  Identities=28%  Similarity=0.506  Sum_probs=24.8

Q ss_pred             CccccCccccccCCCCCCccccccccc-cccccccccc
Q 041672           28 GSATDGCGEFMPSGEEGSIESLKCSAC-NCHRNFHRKE   64 (127)
Q Consensus        28 ghavDGCgEFmpsg~~gt~~aL~CaAC-gCHRnFHRre   64 (127)
                      +++|| |+---|.-..-.+.+|.|.-| |||||++...
T Consensus       514 ~~c~d-c~~~n~~wAslnlg~l~cieCsgihr~lgt~l  550 (749)
T KOG0705|consen  514 SHCVD-CGTPNPKWASLNLGVLMCIECSGIHRNLGTHL  550 (749)
T ss_pred             ceeee-cCCCCcccccccCCeEEEEEchhhhhhhhhhh
Confidence            46666 665544433334569999999 8999998653


No 11 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=29.71  E-value=40  Score=20.24  Aligned_cols=25  Identities=20%  Similarity=0.561  Sum_probs=15.4

Q ss_pred             CccccccCCCCCCcccccccccccc
Q 041672           33 GCGEFMPSGEEGSIESLKCSACNCH   57 (127)
Q Consensus        33 GCgEFmpsg~~gt~~aL~CaACgCH   57 (127)
                      -||..|...+.....-+.|..||=|
T Consensus         5 ~Cg~~l~~~~~~~~~~~vC~~Cg~~   29 (52)
T smart00661        5 KCGNMLIPKEGKEKRRFVCRKCGYE   29 (52)
T ss_pred             CCCCccccccCCCCCEEECCcCCCe
Confidence            4777775543222236889999943


No 12 
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=27.18  E-value=24  Score=26.44  Aligned_cols=14  Identities=43%  Similarity=0.838  Sum_probs=11.1

Q ss_pred             Cccccccccccccc
Q 041672           45 SIESLKCSACNCHR   58 (127)
Q Consensus        45 t~~aL~CaACgCHR   58 (127)
                      -.-.|+|.|||..|
T Consensus       111 r~~~l~C~aCGa~~  124 (125)
T PF01873_consen  111 RLIFLKCKACGASR  124 (125)
T ss_dssp             TCCEEEETTTSCEE
T ss_pred             CEEEEEecccCCcC
Confidence            34589999999876


No 13 
>KOG2767 consensus Translation initiation factor 5 (eIF-5) [Translation, ribosomal structure and biogenesis]
Probab=26.62  E-value=20  Score=32.33  Aligned_cols=17  Identities=35%  Similarity=0.784  Sum_probs=12.9

Q ss_pred             ccccccccccccccccc
Q 041672           48 SLKCSACNCHRNFHRKE   64 (127)
Q Consensus        48 aL~CaACgCHRnFHRre   64 (127)
                      .++|.||||+-+---|.
T Consensus       118 ~~~CkACG~r~~~d~rh  134 (400)
T KOG2767|consen  118 SLKCKACGFRSDMDLRH  134 (400)
T ss_pred             hhHHHHcCCcccccchh
Confidence            78999999987654433


Done!