Citrus Sinensis ID: 041681


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
QFQDSLAIAVQVSLCHLSLSIPTFTMHLISFSPPPPLPTFLLSFSSLLLLLLLVLLQWRQPKDKRFPPGSMGWPYIGETLKLYTQNPNSFFSNRQKRYGDIFKTHILGCPCVMISSPEAAKIVLVSKAHLFKPTYPPSKEKMIGPEALFFHQGAYHSRLKKLVQASFLPSAIRGSVSEIEQIVLKFLPTWKNATINTLQEMKKYAFDVAMISAFGYQHDLEMEGIKNLYQCIEKGYNSMPLDLPGTPYHKAIKAREQLNETLRRLIQKRRESGKQIGGLLGVLLAAKDHKLNQLSDSQIADNIIGVIFAAHDTTASVLTWVLKYLHDNQDLLDAVTREQEGILRQKIEENRGLTWDDTRHMPLTTRVIQETLRTASILSFTFREAVQDVEFEGYIIPRGWKVLPLFRSIHHCADFFPQPEKFDPSRFEAPPRPNTYMPFGNGVHSCPGSELAKLEMHIFIHHLTTTYRSLSFSKFQNLT
cccccHHHHHEEcccEEEECcccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHcccEEEccccccEEEEccHHHHHHHHHccccccccccccHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccccHHHHccccHHHHHHHHHHcccccccccccEEcccEEEccEECccccEEEccHHHHccccccccccccccccccccccccccECcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccc
*****LAIAVQVSLCHLSLSIPTFTMHLISFSPPPPLPTFLLSFSSLLLLLLLVLLQWRQPKDKRFPPGSMGWPYIGETLKLYTQNPNSFFSNRQKRYGDIFKTHILGCPCVMISSPEAAKIVLVSKAHLFKPTYPPSKEKMIGPEALFFHQGAYHSRLKKLVQASFLPSAIRGSVSEIEQIVLKFLPTWKNATINTLQEMKKYAFDVAMISAFGYQHDLEMEGIKNLYQCIEKGYNSMPLDLPGTPYHKAIKAREQLNETLRRLI*******KQIGGLLGVLLAAKDHKLNQLSDSQIADNIIGVIFAAHDTTASVLTWVLKYLHDNQDLLDAVTREQEGILRQKIEENRGLTWDDTRHMPLTTRVIQETLRTASILSFTFREAVQDVEFEGYIIPRGWKVLPLFRSIHHCADFFPQPEKFDPSRFEAPPRPNTYMPFGNGVHSCPGSELAKLEMHIFIHHLTTTYRSLSFSKFQ***
xxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QFQDSLAIAVQVSLCHLSLSIPTFTMHLISFSPPPPLPTFLLSFSSLLLLLLLVLLQWRQPKDKRFPPGSMGWPYIGETLKLYTQNPNSFFSNRQKRYGDIFKTHILGCPCVMISSPEAAKIVLVSKAHLFKPTYPPSKEKMIGPEALFFHQGAYHSRLKKLVQASFLPSAIRGSVSEIEQIVLKFLPTWKNATINTLQEMKKYAFDVAMISAFGYQHDLEMEGIKNLYQCIEKGYNSMPLDLPGTPxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGGLLGVLLAAKDHKLNQLSDSQIADNIIGVIFAAHDTTASVLTWVLKYLHDNQDLLDAVTREQEGILRQKIEENRGLTWDDTRHMPLTTRVIQETLRTASILSFTFREAVQDVEFEGYIIPRGWKVLPLFRSIHHCADFFPQPEKFDPSRFEAPPRPNTYMPFGNGVHSCPGSELAKLEMHIFIHHLTTTYRSLSFSKFQNLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Abscisic acid 8'-hydroxylase 2 Involved in the oxidative degradation of abscisic acid, but not in the isomerization of the produced 8'-hydroxyabscisic acid (8'-OH-ABA) to (-)-phaseic acid (PA). Involved in the control of seed dormancy and germination.confidentO81077
Abscisic acid 8'-hydroxylase 3 Involved in the oxidative degradation of abscisic acid.probableQ0J185
Abscisic acid 8'-hydroxylase 1 Involved in the oxidative degradation of abscisic acid.probableQ05JG2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.13.-With NADH or NADPH as one donor, and incorporation of one atom of oxygen.probable
1.14.13.93(+)-abscisic acid 8'-hydroxylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CZH, chain A
Confidence level:very confident
Coverage over the Query: 78-474
View the alignment between query and template
View the model in PyMOL