Citrus Sinensis ID: 041695

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-
LQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVRGCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARDSVEISGGLGYDVPSGRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSGAHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCLQDGTNPNLVVPMNPGSPSIADTGYYIDILRNRGLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQIGVLTASAGEIRANCRVVN
ccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccccccHHHHHHHHHHccccccccHHHccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHccccccccHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccc
LQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVRGCDASVLIDSTSSNT*EKDS*VNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARDSVEISGGLGYDVPSGRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSGAHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCL***T**NLVVPMNPGSPSIADTGYYIDILRNRGLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQIGVLTASAGEIRANCRVVN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVRGCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARDSVEISGGLGYDVPSGRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSGAHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCLQDGTNPNLVVPMNPGSPSIADTGYYIDILRNRGLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQIGVLTASAGEIRANCRVVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxidase 5 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.confidentA7QEU4
Peroxidase 3 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.probableO23044
Peroxidase 1 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.probableA5H8G4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.11.-.-Acting on a peroxide as acceptor.probable
1.11.1.-Peroxidases.probable
1.11.1.7Peroxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PA2, chain A
Confidence level:very confident
Coverage over the Query: 1-301
View the alignment between query and template
View the model in PyMOL