Query         041697
Match_columns 230
No_of_seqs    143 out of 877
Neff          6.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:44:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041697.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041697hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 5.7E-43 1.2E-47  279.8   5.9  129    8-144     1-129 (129)
  2 PHA00692 hypothetical protein   35.7      15 0.00033   26.0   0.5   11    6-16     35-45  (74)
  3 KOG1334 WD40 repeat protein [G  29.5      75  0.0016   31.5   4.1   74   45-127   341-435 (559)
  4 PF07960 CBP4:  CBP4;  InterPro  28.8      30 0.00064   28.1   1.1   12   14-25     29-40  (128)
  5 PF01473 CW_binding_1:  Putativ  25.9      45 0.00097   17.6   1.2    8   67-74      7-14  (19)
  6 COG1095 RPB7 DNA-directed RNA   24.2      49  0.0011   28.4   1.7   40    7-47     12-51  (183)
  7 PF09174 Maf1:  Maf1 regulator;  23.9      18  0.0004   30.6  -0.9   13   42-54    137-149 (179)
  8 COG4741 Predicted secreted end  23.2      31 0.00068   29.0   0.3   17    3-20     94-110 (175)
  9 smart00265 BH4 BH4 Bcl-2 homol  22.6 1.4E+02  0.0031   17.7   3.0   20   16-35      3-22  (27)
 10 PF13822 ACC_epsilon:  Acyl-CoA  22.3      45 0.00098   23.3   1.0    9   15-23     10-18  (62)
 11 smart00707 RPEL Repeat in Dros  21.5      63  0.0014   19.1   1.3   13   11-23      6-18  (26)
 12 PLN02417 dihydrodipicolinate s  21.4      48   0.001   29.6   1.2   19    7-26    102-120 (280)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=5.7e-43  Score=279.83  Aligned_cols=129  Identities=35%  Similarity=0.641  Sum_probs=94.9

Q ss_pred             CCCCceeCCChHHHHHHHHHHHHhCCCCCcccceeeeccCCCCCCCcccccCCCCCCCCCCcEEEEecccccCCCCCccc
Q 041697            8 LPHGFQFRPSDEELVEHYLKKKVSGTLIPLAEYFIRDCNLYETKPSKIWDSHGGPFLNADEDLYFFTQLKKKSSKGSRID   87 (230)
Q Consensus         8 LPpGfRF~PTDeELI~~YL~~Ki~g~~~p~~~~vI~~~DvY~~ePw~L~~~~~~~~~~~~~~wYFFs~r~~k~~~g~R~~   87 (230)
                      |||||||+|||+|||.+||++|+.|.++|.. .+|+++|||+++||+|+..+.    .++.+||||++++++++++.|.+
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~-~~i~~~Diy~~~P~~L~~~~~----~~~~~~yFF~~~~~~~~~~~r~~   75 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCE-DVIHDVDIYSAHPWELPAKFK----GGDEEWYFFSPRKKKYPNGGRPN   75 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS--CHSEE--GGGS-GGGCHHHSS----S-SSEEEEEEE----------S-
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcc-cceeecccCccChHHhhhhcc----CCCceEEEEEecccccCCccccc
Confidence            8999999999999999999999999987774 479999999999999995322    35679999999999999999999


Q ss_pred             cccCCCCceeeeccCCceEEeCCCceEEEEEEEeecCcCCCCCCCCCCeEEEEEEeC
Q 041697           88 RKVGSSGGAWQGEDAGKDIVSGQSKIKIGSKKQFRYEKKDLPKNQATNYVLCRLRKN  144 (230)
Q Consensus        88 R~v~~~~G~Wk~~g~~k~I~~~~~g~~iG~Kk~l~fy~~~~~~~~kt~WvM~Ey~l~  144 (230)
                      |+++  +|+||++|+.++|.+. ++.+||+|++|+||.+..+++.+|+|+|+||+|.
T Consensus        76 R~~~--~G~Wk~~g~~~~i~~~-~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   76 RVTG--GGYWKSTGKEKPIKDP-GGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             EEET--TEEEEEECEEEEEEE--TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             cccc--ceEEeecccccccccc-cceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            9888  9999999999999986 5689999999999988888889999999999983


No 2  
>PHA00692 hypothetical protein
Probab=35.75  E-value=15  Score=25.97  Aligned_cols=11  Identities=36%  Similarity=0.615  Sum_probs=8.3

Q ss_pred             CCCCCCceeCC
Q 041697            6 PFLPHGFQFRP   16 (230)
Q Consensus         6 ~~LPpGfRF~P   16 (230)
                      ...||||||--
T Consensus        35 veyppgfrfgg   45 (74)
T PHA00692         35 VEYPPGFRFGG   45 (74)
T ss_pred             EecCCCccccc
Confidence            35799999953


No 3  
>KOG1334 consensus WD40 repeat protein [General function prediction only]
Probab=29.47  E-value=75  Score=31.48  Aligned_cols=74  Identities=30%  Similarity=0.396  Sum_probs=46.0

Q ss_pred             ccCCCCCCCcccccCCCCCCCCCCcEEEEecccccC----------------CCCCccccccCCCCceeeeccCCceEEe
Q 041697           45 CNLYETKPSKIWDSHGGPFLNADEDLYFFTQLKKKS----------------SKGSRIDRKVGSSGGAWQGEDAGKDIVS  108 (230)
Q Consensus        45 ~DvY~~ePw~L~~~~~~~~~~~~~~wYFFs~r~~k~----------------~~g~R~~R~v~~~~G~Wk~~g~~k~I~~  108 (230)
                      +=+|.++|-+|...      ..+...|||.+-....                =+|.|-+|++++ .-+|=..  ..-|++
T Consensus       341 gl~Ysh~~sElLaS------YnDe~IYLF~~~~~~G~~p~~~s~~~~~~k~vYKGHrN~~TVKg-VNFfGPr--sEyVvS  411 (559)
T KOG1334|consen  341 GLVYSHDGSELLAS------YNDEDIYLFNKSMGDGSEPDPSSPREQYVKRVYKGHRNSRTVKG-VNFFGPR--SEYVVS  411 (559)
T ss_pred             eEEecCCccceeee------ecccceEEeccccccCCCCCCCcchhhccchhhcccccccccce-eeeccCc--cceEEe
Confidence            34577777777643      3466789996432211                136777888876 7788753  345555


Q ss_pred             C--CCceEEEEEEE---eecCcCC
Q 041697          109 G--QSKIKIGSKKQ---FRYEKKD  127 (230)
Q Consensus       109 ~--~~g~~iG~Kk~---l~fy~~~  127 (230)
                      +  .+..+||.|++   +.|.+++
T Consensus       412 GSDCGhIFiW~K~t~eii~~MegD  435 (559)
T KOG1334|consen  412 GSDCGHIFIWDKKTGEIIRFMEGD  435 (559)
T ss_pred             cCccceEEEEecchhHHHHHhhcc
Confidence            4  35567888864   5566654


No 4  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=28.79  E-value=30  Score=28.12  Aligned_cols=12  Identities=42%  Similarity=0.841  Sum_probs=10.1

Q ss_pred             eCCChHHHHHHH
Q 041697           14 FRPSDEELVEHY   25 (230)
Q Consensus        14 F~PTDeELI~~Y   25 (230)
                      =.||||||+..|
T Consensus        29 ~tPTeEeL~~r~   40 (128)
T PF07960_consen   29 TTPTEEELFKRY   40 (128)
T ss_pred             cCCCHHHHHHhc
Confidence            379999999875


No 5  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=25.90  E-value=45  Score=17.55  Aligned_cols=8  Identities=25%  Similarity=0.949  Sum_probs=6.6

Q ss_pred             CCcEEEEe
Q 041697           67 DEDLYFFT   74 (230)
Q Consensus        67 ~~~wYFFs   74 (230)
                      ++.||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            57899995


No 6  
>COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription]
Probab=24.24  E-value=49  Score=28.43  Aligned_cols=40  Identities=25%  Similarity=0.227  Sum_probs=31.0

Q ss_pred             CCCCCceeCCChHHHHHHHHHHHHhCCCCCcccceeeeccC
Q 041697            7 FLPHGFQFRPSDEELVEHYLKKKVSGTLIPLAEYFIRDCNL   47 (230)
Q Consensus         7 ~LPpGfRF~PTDeELI~~YL~~Ki~g~~~p~~~~vI~~~Dv   47 (230)
                      .+||- .|.|--+++|...|+.|..|+.....+.+|...|+
T Consensus        12 ripP~-~fg~~~~~~v~~~L~~k~eG~~~~~~G~~v~V~~v   51 (183)
T COG1095          12 RIPPS-YFGEDLEEAVKEELKEKYEGKLDGDVGLVVLVLDV   51 (183)
T ss_pred             EeCHH-HcCccHHHHHHHHHHHHhcceEccccCEEEEEEEe
Confidence            46776 68888999999999999999766555556666555


No 7  
>PF09174 Maf1:  Maf1 regulator;  InterPro: IPR015257 Maf1 is a negative regulator of RNA polymerase III [, ]. It targets the initiation factor TFIIIB []. ; PDB: 3NR5_A.
Probab=23.90  E-value=18  Score=30.56  Aligned_cols=13  Identities=31%  Similarity=1.071  Sum_probs=7.4

Q ss_pred             eeeccCCCCCCCc
Q 041697           42 IRDCNLYETKPSK   54 (230)
Q Consensus        42 I~~~DvY~~ePw~   54 (230)
                      +.+||||.+.|..
T Consensus       137 l~~C~iYsy~pd~  149 (179)
T PF09174_consen  137 LKDCDIYSYNPDS  149 (179)
T ss_dssp             GGG-EEEEE---G
T ss_pred             ccCceEEEEccCC
Confidence            6689999999943


No 8  
>COG4741 Predicted secreted endonuclease distantly related to archaeal Holliday junction resolvase [Nucleotide transport and metabolism]
Probab=23.25  E-value=31  Score=29.04  Aligned_cols=17  Identities=35%  Similarity=0.962  Sum_probs=12.0

Q ss_pred             CCCCCCCCCceeCCChHH
Q 041697            3 EHIPFLPHGFQFRPSDEE   20 (230)
Q Consensus         3 ~~~~~LPpGfRF~PTDeE   20 (230)
                      ++++-+| +|+|+|.|.-
T Consensus        94 qlaPffp-~f~ynPkD~R  110 (175)
T COG4741          94 QLAPFFP-EFKYNPKDAR  110 (175)
T ss_pred             hhccccc-CCCcCCccce
Confidence            3444455 9999999953


No 9  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=22.64  E-value=1.4e+02  Score=17.73  Aligned_cols=20  Identities=30%  Similarity=0.326  Sum_probs=15.8

Q ss_pred             CChHHHHHHHHHHHHhCCCC
Q 041697           16 PSDEELVEHYLKKKVSGTLI   35 (230)
Q Consensus        16 PTDeELI~~YL~~Ki~g~~~   35 (230)
                      .+-.|||.+|+.-|+.-+-.
T Consensus         3 ~~nRelV~~yv~yKLsQrgy   22 (27)
T smart00265        3 LDNRELVVDYVTYKLSQNGY   22 (27)
T ss_pred             cchHHHHHHHHHHHHhhcCC
Confidence            35689999999999976533


No 10 
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=22.25  E-value=45  Score=23.33  Aligned_cols=9  Identities=56%  Similarity=0.940  Sum_probs=7.8

Q ss_pred             CCChHHHHH
Q 041697           15 RPSDEELVE   23 (230)
Q Consensus        15 ~PTDeELI~   23 (230)
                      +||||||-.
T Consensus        10 nPt~eElAA   18 (62)
T PF13822_consen   10 NPTDEELAA   18 (62)
T ss_pred             CCCHHHHHH
Confidence            799999865


No 11 
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=21.52  E-value=63  Score=19.07  Aligned_cols=13  Identities=46%  Similarity=0.639  Sum_probs=11.0

Q ss_pred             CceeCCChHHHHH
Q 041697           11 GFQFRPSDEELVE   23 (230)
Q Consensus        11 GfRF~PTDeELI~   23 (230)
                      ...++||-||||.
T Consensus         6 kl~~RP~~eeLv~   18 (26)
T smart00707        6 KLSQRPTREELEE   18 (26)
T ss_pred             HHHcCCCHHHHHH
Confidence            4568999999997


No 12 
>PLN02417 dihydrodipicolinate synthase
Probab=21.41  E-value=48  Score=29.60  Aligned_cols=19  Identities=21%  Similarity=0.426  Sum_probs=15.0

Q ss_pred             CCCCCceeCCChHHHHHHHH
Q 041697            7 FLPHGFQFRPSDEELVEHYL   26 (230)
Q Consensus         7 ~LPpGfRF~PTDeELI~~YL   26 (230)
                      -+|| +.|.||++||+.||-
T Consensus       102 ~~~P-~y~~~~~~~i~~~f~  120 (280)
T PLN02417        102 HINP-YYGKTSQEGLIKHFE  120 (280)
T ss_pred             EcCC-ccCCCCHHHHHHHHH
Confidence            4566 458999999999773


Done!