Query         041701
Match_columns 83
No_of_seqs    106 out of 141
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 09:46:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041701.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041701hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03070 photosystem I reactio  32.7      33 0.00072   24.4   1.8   20    1-20      1-20  (128)
  2 smart00107 BTK Bruton's tyrosi  15.2      84  0.0018   17.5   0.8   13   60-72      3-15  (36)
  3 PF04817 Umbravirus_LDM:  Umbra  13.2 2.7E+02  0.0059   21.6   3.3   55    6-69      1-55  (231)
  4 COG4894 Uncharacterized conser   7.7 1.2E+02  0.0026   22.3  -0.3   12   63-74     99-110 (159)
  5 PF08057 Ery_res_leader2:  Eryt   7.6   2E+02  0.0043   13.1   0.5   12    1-12      1-12  (14)
  6 PF15060 PPDFL:  Differentiatio   7.2 2.6E+02  0.0057   19.4   1.2   31    6-37      1-31  (110)
  7 cd01998 tRNA_Me_trans tRNA met   7.1 1.4E+02   0.003   23.4  -0.2   23   17-39    171-193 (349)
  8 TIGR00315 cdhB CO dehydrogenas   7.1 1.9E+02  0.0041   20.7   0.5   20   60-79    137-157 (162)
  9 PF03054 tRNA_Me_trans:  tRNA m   6.8 1.1E+02  0.0024   24.5  -0.9   24   16-39    174-197 (356)
 10 COG1880 CdhB CO dehydrogenase/   6.7 1.7E+02  0.0038   21.7   0.2   13   67-79    153-165 (170)

No 1  
>PLN03070 photosystem I reaction center subunit psaK 247; Provisional
Probab=32.70  E-value=33  Score=24.40  Aligned_cols=20  Identities=30%  Similarity=0.586  Sum_probs=16.6

Q ss_pred             CcccccccccccccccCccc
Q 041701            1 MAHQLMTSVPALTRLQEPRS   20 (83)
Q Consensus         1 ~~~~~~~~~p~~~~l~~~~~   20 (83)
                      ||-+|+++.|.|.-|-...+
T Consensus         1 ~~~~~~~~~p~F~glr~~~~   20 (128)
T PLN03070          1 MASTMMTTLPQFNGLRASSA   20 (128)
T ss_pred             Cccccccccccccccccccc
Confidence            89999999999987766544


No 2  
>smart00107 BTK Bruton's tyrosine kinase Cys-rich motif. Zinc-binding motif containing conserved cysteines and a histidine. Always found C-terminal to PH domains (but not all PH domains are followed by BTK motifs). The crystal structure shows this motif packs against the PH domain. The PH+Btk module pair has been called the Tec homology (TH) region.
Probab=15.16  E-value=84  Score=17.46  Aligned_cols=13  Identities=31%  Similarity=0.703  Sum_probs=10.4

Q ss_pred             ccCCCCCCCCCch
Q 041701           60 RRSANYQPSMWSY   72 (83)
Q Consensus        60 RRSaNY~PSiWd~   72 (83)
                      .|...|||..|-+
T Consensus         3 ~~l~~yHP~~~~~   15 (36)
T smart00107        3 NLLQKYHPSFWVD   15 (36)
T ss_pred             ccccccCCCceeC
Confidence            5678899999954


No 3  
>PF04817 Umbravirus_LDM:  Umbravirus long distance movement (LDM) family ;  InterPro: IPR006902 The long distance movement protein of Umbraviruses mediates the movement of viral RNA through the phloem of infected plants [].
Probab=13.19  E-value=2.7e+02  Score=21.63  Aligned_cols=55  Identities=11%  Similarity=0.151  Sum_probs=37.7

Q ss_pred             cccccccccccCccccccccCCCccccCCCCccccCCcccccccccccccccccccCCCCCCCC
Q 041701            6 MTSVPALTRLQEPRSFISSLGSPSISKSNSNGFCASPIQCMSATKVRDKAINDNRRSANYQPSM   69 (83)
Q Consensus         6 ~~~~p~~~~l~~~~~~~~~~~~~~~~~~~s~~~~~~~v~C~~~~~~~~~~~~v~RRSaNY~PSi   69 (83)
                      |++|.+|+ .-.-+++.+-.-+++++.++..|+...+..|.....        .|+-++-+|.+
T Consensus         1 MssiiNV~-~n~ksr~~r~~~~~svRrg~~~~a~g~kpr~~~~~~--------rr~~g~~hpa~   55 (231)
T PF04817_consen    1 MSSIINVN-ANGKSRNSRRAPQSSVRRGDRKGARGDKPRSPHPPP--------RRPKGGMHPAT   55 (231)
T ss_pred             Cceeeeec-cCCccccCCCCCCCCcccCCccCCCCCCCCCCCCCc--------cccCCCCCCCC
Confidence            56777663 222345566778899999999999988888876522        35566666654


No 4  
>COG4894 Uncharacterized conserved protein [Function unknown]
Probab=7.69  E-value=1.2e+02  Score=22.32  Aligned_cols=12  Identities=8%  Similarity=0.537  Sum_probs=9.6

Q ss_pred             CCCCCCCCchhh
Q 041701           63 ANYQPSMWSYDY   74 (83)
Q Consensus        63 aNY~PSiWd~df   74 (83)
                      =.-|.|+||+.|
T Consensus        99 ~eihGNi~d~ef  110 (159)
T COG4894          99 WEIHGNIWDDEF  110 (159)
T ss_pred             eEEecceeceEE
Confidence            456899999887


No 5  
>PF08057 Ery_res_leader2:  Erythromycin resistance leader peptide;  InterPro: IPR012559 This family consists of erythromycin resistance gene leader peptides. These leader peptides are involved in the transcriptional attenuation control of the synthesis of the macrolide-lincosamide -streptogramin B resistance protein. It acts as a transcriptional attenuator, in contrast to other inducible erm genes. The mRNA leader sequence can fold in either of two mutually exclusive conformations, one of which is postulated to form in the absence of induction, and to contain two rho factor-independent terminators [].; GO: 0046677 response to antibiotic
Probab=7.61  E-value=2e+02  Score=13.13  Aligned_cols=12  Identities=33%  Similarity=0.639  Sum_probs=6.2

Q ss_pred             Cccccccccccc
Q 041701            1 MAHQLMTSVPAL   12 (83)
Q Consensus         1 ~~~~~~~~~p~~   12 (83)
                      |.|+|--.+|.|
T Consensus         1 mthsmrlrfptl   12 (14)
T PF08057_consen    1 MTHSMRLRFPTL   12 (14)
T ss_pred             Cccceeeecccc
Confidence            455555555544


No 6  
>PF15060 PPDFL:  Differentiation and proliferation regulator
Probab=7.17  E-value=2.6e+02  Score=19.41  Aligned_cols=31  Identities=23%  Similarity=0.325  Sum_probs=14.9

Q ss_pred             cccccccccccCccccccccCCCccccCCCCc
Q 041701            6 MTSVPALTRLQEPRSFISSLGSPSISKSNSNG   37 (83)
Q Consensus         6 ~~~~p~~~~l~~~~~~~~~~~~~~~~~~~s~~   37 (83)
                      ||+||+---|=.-+-.-++ ++.+.+.++|||
T Consensus         1 MAaIPSsGsL~At~~YYRr-~~~S~sS~sSc~   31 (110)
T PF15060_consen    1 MAAIPSSGSLVATHDYYRR-RLGSTSSNSSCG   31 (110)
T ss_pred             CCccccccceeecchhhhh-ccccccccCCcC
Confidence            5778854322222222222 455555566665


No 7  
>cd01998 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The  archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.
Probab=7.13  E-value=1.4e+02  Score=23.35  Aligned_cols=23  Identities=39%  Similarity=0.712  Sum_probs=19.5

Q ss_pred             CccccccccCCCccccCCCCccc
Q 041701           17 EPRSFISSLGSPSISKSNSNGFC   39 (83)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~s~~~~   39 (83)
                      +++..+..++.|...|..||+.|
T Consensus       171 eVr~~A~~~gl~~~~k~~s~~iC  193 (349)
T cd01998         171 EVREIAKELGLPVAKKKDSQGIC  193 (349)
T ss_pred             HHHHHHHHcCCCCCCCCCCCceE
Confidence            44566778899999999999999


No 8  
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit. Nomenclature follows the description for Methanosarcina thermophila. The complex is also found in Archaeoglobus fulgidus, not considered a methanogen, but is otherwise generally associated with methanogenesis.
Probab=7.05  E-value=1.9e+02  Score=20.75  Aligned_cols=20  Identities=30%  Similarity=0.612  Sum_probs=15.4

Q ss_pred             ccCCCCC-CCCCchhhhhccc
Q 041701           60 RRSANYQ-PSMWSYDYLQSLS   79 (83)
Q Consensus        60 RRSaNY~-PSiWd~dfIqSL~   79 (83)
                      -+.|.|. ||+++++++++|.
T Consensus       137 ~pnA~~Sf~n~~~~~~~~~l~  157 (162)
T TIGR00315       137 QPNADYSFPNLSKDEYLDYLR  157 (162)
T ss_pred             CCCCceeccccCHHHHHHHHH
Confidence            4567777 8888888888775


No 9  
>PF03054 tRNA_Me_trans:  tRNA methyl transferase;  InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34.; GO: 0016740 transferase activity, 0008033 tRNA processing, 0005737 cytoplasm; PDB: 2DET_A 2DER_A 2DEU_A 2HMA_A.
Probab=6.82  E-value=1.1e+02  Score=24.54  Aligned_cols=24  Identities=33%  Similarity=0.613  Sum_probs=14.8

Q ss_pred             cCccccccccCCCccccCCCCccc
Q 041701           16 QEPRSFISSLGSPSISKSNSNGFC   39 (83)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~s~~~~   39 (83)
                      ++.++.+..+++|...|.-|||.|
T Consensus       174 ~eVR~iA~~~gl~~a~k~eSq~iC  197 (356)
T PF03054_consen  174 EEVREIAREAGLPVAEKKESQGIC  197 (356)
T ss_dssp             HHHHHHHHHCT-TTTT-----SST
T ss_pred             HHHHHHHHhcCCcccCccccceEE
Confidence            345677888999999999999999


No 10 
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion]
Probab=6.74  E-value=1.7e+02  Score=21.70  Aligned_cols=13  Identities=31%  Similarity=0.570  Sum_probs=10.6

Q ss_pred             CCCCchhhhhccc
Q 041701           67 PSMWSYDYLQSLS   79 (83)
Q Consensus        67 PSiWd~dfIqSL~   79 (83)
                      ||+|.++|++.|.
T Consensus       153 pNl~kde~~~~L~  165 (170)
T COG1880         153 PNLSKDEYLAYLD  165 (170)
T ss_pred             CCcCHHHHHHHHH
Confidence            6789999988775


Done!