BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041704
(86 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3IZR|Y Chain Y, Localization Of The Large Subunit Ribosomal Proteins
Into A 5.5 A Cryo-Em Map Of Triticum Aestivum
Translating 80s Ribosome
Length = 150
Score = 48.5 bits (114), Expect = 9e-07, Method: Compositional matrix adjust.
Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 11/60 (18%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDPRIPLEPVGHSSV 61
S+ +RKDDEVQVV G+YKGREGK VQ++ +R V+ E RI E V S+V
Sbjct: 46 SIPIRKDDEVQVVRGSYKGREGKVVQVY------RRRWVIHVE-----RITREKVNGSTV 94
>pdb|2ZKR|TT Chain t, Structure Of A Mammalian Ribosomal 60s Subunit Within An
80s Complex Obtained By Docking Homology Models Of The
Rna And Proteins Into An 8.7 A Cryo-Em Map
Length = 145
Score = 39.3 bits (90), Expect = 6e-04, Method: Compositional matrix adjust.
Identities = 19/29 (65%), Positives = 24/29 (82%), Gaps = 1/29 (3%)
Query: 2 SMSVRKDDEVQVVGGTYKGRE-GKFVQIF 29
SM +RKDDEVQVV G YKG++ GK VQ++
Sbjct: 46 SMPIRKDDEVQVVRGHYKGQQIGKVVQVY 74
>pdb|4A17|S Chain S, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 5s Rrna, 5.8s
Rrna And Proteins Of Molecule 2.
pdb|4A1A|S Chain S, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 5s Rrna, 5.8s
Rrna And Proteins Of Molecule 3.
pdb|4A1C|S Chain S, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 5s Rrna, 5.8s
Rrna And Proteins Of Molecule 4.
pdb|4A1E|S Chain S, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 5s Rrna, 5.8s
Rrna And Proteins Of Molecule 1
Length = 135
Score = 38.1 bits (87), Expect = 0.001, Method: Compositional matrix adjust.
Identities = 16/28 (57%), Positives = 21/28 (75%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIF 29
SM VRKDDEV +V G +KG +GK Q++
Sbjct: 46 SMPVRKDDEVLIVRGKFKGNKGKVTQVY 73
>pdb|3ZF7|Z Chain Z, High-resolution Cryo-electron Microscopy Structure Of
The Trypanosoma Brucei Ribosome
Length = 143
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 16/30 (53%), Positives = 21/30 (70%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFAI 31
SM VRKDDEV+V G +KGREG+ + +
Sbjct: 44 SMPVRKDDEVRVKRGKFKGREGRVTACYRL 73
>pdb|3IZS|Y Chain Y, Localization Of The Large Subunit Ribosomal Proteins
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae
Translating 80s Ribosome
Length = 123
Score = 34.3 bits (77), Expect = 0.019, Method: Compositional matrix adjust.
Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDPRIPLE 54
++ +R+DDEV VV G+ KG+EGK ++ + V+ D V+ E + +P+
Sbjct: 47 ALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAVQVD-KVTKEKVNGASVPIN 98
>pdb|2WW9|L Chain L, Cryo-Em Structure Of The Active Yeast Ssh1 Complex Bound
To The Yeast 80s Ribosome
pdb|2WWA|L Chain L, Cryo-Em Structure Of Idle Yeast Ssh1 Complex Bound To
The Yeast 80s Ribosome
pdb|2WWB|L Chain L, Cryo-Em Structure Of The Mammalian Sec61 Complex Bound
To The Actively Translating Wheat Germ 80s Ribosome
pdb|3O58|X Chain X, Yeast 80s Ribosome. This Entry Consists Of The 60s
Subunit Of The First 80s In The Asymmetric Unit.
pdb|3O5H|X Chain X, Yeast 80s Ribosome. This Entry Consists Of The 60s
Subunit Of The Second 80s In The Asymmetric Unit.
pdb|3U5E|Y Chain Y, The Structure Of The Eukaryotic Ribosome At 3.0 A
Resolution. This Entry Contains Proteins Of The 60s
Subunit, Ribosome A
pdb|3U5I|Y Chain Y, The Structure Of The Eukaryotic Ribosome At 3.0 A
Resolution. This Entry Contains Proteins Of The 60s
Subunit, Ribosome B
pdb|4B6A|Y Chain Y, Cryo-Em Structure Of The 60s Ribosomal Subunit In
Complex With Arx1 And Rei1
Length = 127
Score = 34.3 bits (77), Expect = 0.020, Method: Compositional matrix adjust.
Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDPRIPLE 54
++ +R+DDEV VV G+ KG+EGK ++ + V+ D V+ E + +P+
Sbjct: 47 ALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAVQVD-KVTKEKVNGASVPIN 98
>pdb|3JYW|U Chain U, Structure Of The 60s Proteins For Eukaryotic Ribosome
Based On Cryo-Em Map Of Thermomyces Lanuginosus
Ribosome At 8.9a Resolution
Length = 116
Score = 33.9 bits (76), Expect = 0.021, Method: Compositional matrix adjust.
Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDPRIPLE 54
++ +R+DDEV VV G+ KG+EGK ++ + V+ D V+ E + +P+
Sbjct: 39 ALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAVQVD-KVTKEKVNGASVPIN 90
>pdb|1S1I|U Chain U, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex
From Yeast Obtained By Docking Atomic Models For Rna
And Protein Components Into A 11.7 A Cryo-Em Map. This
File, 1s1i, Contains 60s Subunit. The 40s Ribosomal
Subunit Is In File 1s1h
Length = 126
Score = 33.9 bits (76), Expect = 0.022, Method: Compositional matrix adjust.
Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDPRIPLE 54
++ +R+DDEV VV G+ KG+EGK ++ + V+ D V+ E + +P+
Sbjct: 46 ALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAVQVD-KVTKEKVNGASVPIN 97
>pdb|3E1B|O Chain O, Structure Of The 50s Subunit Of E. Coli Ribosome In
Pre-Accommodation State
pdb|3E1D|O Chain O, Structure Of The 50s Subunit Of E. Coli Ribosome In
Post-Accommodation State
Length = 103
Score = 28.9 bits (63), Expect = 0.77, Method: Compositional matrix adjust.
Identities = 12/30 (40%), Positives = 19/30 (63%)
Query: 1 MSMSVRKDDEVQVVGGTYKGREGKFVQIFA 30
M+ +R+DDEV V+ G KG+ GK + +
Sbjct: 1 MAAKIRRDDEVIVLTGKDKGKRGKVKNVLS 30
>pdb|1VS6|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described
In Remark 400.
pdb|1VS8|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described
In Remark 400.
pdb|3I1N|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1P|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1R|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1T|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I20|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I22|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3KCR|U Chain U, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
Ribosomal Subnit. The 30s Ribosomal Subunit Can Be
Found In Pdb Entry 3kc4
pdb|1VT2|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3ORB|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 50s Subunit Of The
First 70s Ribosome Bound To Cem-101.
pdb|3IZT|V Chain V, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding. This Entry Contains The
Large Subunit Of A Ribosome Programmed With A
Near-Cognate Codon.
pdb|3IZU|V Chain V, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding. This Entry Contains The
Large Subunit Of A Ribosome Programmed With A Cognate
Codon
pdb|3SGF|Y Chain Y, Crystal Structure Of Release Factor Rf3 Trapped In The
Gtp State On A Rotated Conformation Of The Ribosome
pdb|3UOS|Y Chain Y, Crystal Structure Of Release Factor Rf3 Trapped In The
Gtp State On A Rotated Conformation Of The Ribosome
(Without Viomycin)
pdb|4GAR|U Chain U, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
pdb|4GAU|U Chain U, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
Length = 104
Score = 28.9 bits (63), Expect = 0.78, Method: Compositional matrix adjust.
Identities = 12/30 (40%), Positives = 19/30 (63%)
Query: 1 MSMSVRKDDEVQVVGGTYKGREGKFVQIFA 30
M+ +R+DDEV V+ G KG+ GK + +
Sbjct: 1 MAAKIRRDDEVIVLTGKDKGKRGKVKNVLS 30
>pdb|3FIN|Y Chain Y, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
6.4 A Cryo-Em Map. This File Contains The 50s Subunit
Length = 101
Score = 28.5 bits (62), Expect = 0.88, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 17/29 (58%)
Query: 1 MSMSVRKDDEVQVVGGTYKGREGKFVQIF 29
+ M V+K D V V G YKGR GK ++
Sbjct: 2 VKMHVKKGDTVLVASGKYKGRVGKVKEVL 30
>pdb|3TVE|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Leu Complex
pdb|3TVH|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Leu Complex
Length = 102
Score = 28.5 bits (62), Expect = 0.92, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 17/29 (58%)
Query: 1 MSMSVRKDDEVQVVGGTYKGREGKFVQIF 29
+ M V+K D V V G YKGR GK ++
Sbjct: 2 VKMHVKKGDTVLVASGKYKGRVGKVKEVL 30
>pdb|3PYO|U Chain U, Crystal Structure Of A Complex Containing Domain 3 From
The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
File Contains The 50s Subunit Of The First 70s
Ribosome.
pdb|3PYR|U Chain U, Crystal Structure Of A Complex Containing Domain 3 From
The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
File Contains The 50s Subunit Of The Second 70s
Ribosome.
pdb|3PYT|U Chain U, Crystal Structure Of A Complex Containing Domain 3 Of
Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
Contains The 50s Subunit Of The First 70s Ribosome.
pdb|3PYV|U Chain U, Crystal Structure Of A Complex Containing Domain 3 Of
Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
Contains The 50s Subunit Of The Second 70s Ribosome
Length = 100
Score = 28.5 bits (62), Expect = 0.92, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 17/29 (58%)
Query: 1 MSMSVRKDDEVQVVGGTYKGREGKFVQIF 29
+ M V+K D V V G YKGR GK ++
Sbjct: 2 VKMHVKKGDTVLVASGKYKGRVGKVKEVL 30
>pdb|2J01|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Mrna, Trna And Paromomycin (Part 2 Of
4). This File Contains The 50s Subunit From Molecule I.
pdb|2J03|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Mrna, Trna And Paromomycin (Part 4 Of
4). This File Contains The 50s Subunit From Molecule
Ii.
pdb|2HGJ|X Chain X, Crystal Structure Of The 70s Thermus Thermophilus
Ribosome Showing How The 16s 3'-End Mimicks Mrna E And
P Codons. This Entry 2hgj Contains 50s Ribosomal
Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb
Entry 2hgi.
pdb|2HGQ|X Chain X, Crystal Structure Of The 70s Thermus Thermophilus
Ribosome With Translocated And Rotated Shine-Dalgarno
Duplex. This Entry 2hgq Contains 50s Ribosomal Subunit.
The 30s Ribosomal Subunit Can Be Found In Pdb Entry
2hgp.
pdb|2HGU|X Chain X, 70s T.Th. Ribosome Functional Complex With Mrna And E-
And P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
Found In Pdb Entry 2hgr.
pdb|1VSA|S Chain S, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
Functional Interactions And Rearrangements. This File,
1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
Subunit Is In The File 2ow8
pdb|2V47|Y Chain Y, Structure Of The Ribosome Recycling Factor Bound To The
Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
And Trna-Fmet (Part 2 Of 4). This File Contains The 50s
Subunit For Molecule 1.
pdb|2V49|Y Chain Y, Structure Of The Ribosome Recycling Factor Bound To The
Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
And Trna-Fmet (Part 4 Of 4). This File Contains The 50s
Subunit Of Molecule 2.
pdb|1VSP|S Chain S, Interactions And Dynamics Of The Shine-Dalgarno Helix In
The 70s Ribosome. This File, 1vsp, Contains The 50s
Ribosome Subunit. 30s Ribosome Subunit Is In The File
2qnh
pdb|3D5B|Y Chain Y, Structural Basis For Translation Termination On The 70s
Ribosome. This File Contains The 50s Subunit Of One 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes As Described In Remark 400.
pdb|3D5D|Y Chain Y, Structural Basis For Translation Termination On The 70s
Ribosome. This File Contains The 50s Subunit Of The
Second 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes As Described In Remark 400.
pdb|3F1F|Y Chain Y, Crystal Structure Of A Translation Termination Complex
Formed With Release Factor Rf2. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes As Described In
Remark 400.
pdb|3F1H|Y Chain Y, Crystal Structure Of A Translation Termination Complex
Formed With Release Factor Rf2. This File Contains The
50s Subunit Of The Second 70s Ribosome. The Entire
Crystal Structure Contains Two 70s Ribosomes As
Described In Remark 400.
pdb|2WDI|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A-Site Trna,
Deacylated P-Site Trna, And E-Site Trna. This File
Contains The 50s Subunit For Molecule I.
pdb|2WDJ|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A-Site Trna,
Deacylated P-Site Trna, And E-Site Trna. This File
Contains The 50s Subunit For Molecule Ii.
pdb|2WDL|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A- And P-Site
Trnas, And E-Site Trna. This File Contains The 50s
Subunit For Molecule I.
pdb|2WDN|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A- And P-Site
Trnas, And E-Site Trna. This File Contains The 50s
Subunit For Molecule Ii.
pdb|2WH2|Y Chain Y, Insights Into Translational Termination From The
Structure Of Rf2 Bound To The Ribosome
pdb|2WH4|Y Chain Y, Insights Into Translational Termination From The
Structure Of Rf2 Bound To The Ribosome
pdb|3HUX|Y Chain Y, Structure Of Ef-P Bound To The 70s Ribosome; This File
Contains The 50s Subunit For Molecule I.
pdb|3HUZ|Y Chain Y, Structure Of Ef-P Bound To The 70s Ribosome; This File
Contains The 50s Subunit For Molecule Ii.
pdb|2WRJ|Y Chain Y, The Structure Of The Ribosome With Elongation Factor G
Trapped In The Post-Translocational State (Part 2 Of
4).
pdb|2WRL|Y Chain Y, The Structure Of The Ribosome With Elongation Factor G
Trapped In The Post-Translocational State. (Part 4 Of
4).
pdb|2WRO|Y Chain Y, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
And Trna (Part 2 Of 4).
pdb|2WRR|Y Chain Y, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
And Trna (Part 4 Of 4).
pdb|3KIR|Y Chain Y, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Precleavage State; Part 2 Of 4)
pdb|3KIT|Y Chain Y, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Precleavage State; Part 4 Of 4)
pdb|3KIW|Y Chain Y, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Postcleavage State; Part 2 Of 4)
pdb|3KIY|Y Chain Y, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Postcleavage State; Part 4 Of 4)
pdb|3KNI|Y Chain Y, The Structures Of Viomycin Bound To The 70s Ribosome.
This File Contains The 50s Subunit For Molecule I
pdb|3KNK|Y Chain Y, The Structures Of Viomycin Bound To The 70s Ribosome.
This File Contains The 50s Subunit For Molecule Ii.
pdb|3KNM|Y Chain Y, The Structures Of Capreomycin Bound To The 70s Ribosome.
Thi Contains The 50s Subunit For Molecule I.
pdb|3KNO|Y Chain Y, The Structures Of Capreomycin Bound To The 70s Ribosome.
Thi Contains The 50s Subunit For Molecule Ii
pdb|3I8F|U Chain U, Elongation Complex Of The 70s Ribosome With Three Trnas
And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
(50s).
pdb|3I8I|U Chain U, Elongation Complex Of The 70s Ribosome With Three Trnas
And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
(30s).
pdb|3I9C|U Chain U, Initiation Complex Of 70s Ribosome With Two Trnas And
Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule
B. The 30s Subunit Can Be Found In Pdb Entry 3i9b.
Molecule A In The S Asymmetric Unit Is Deposited As
3i9d (30s) And 3i9e (50s)
pdb|3I9E|U Chain U, Initiation Complex Of 70s Ribosome With Two Trnas And
Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule
A. The 30s Subunit Can Be Found In Pdb Entry 3i9d.
Molecule B In The S Asymmetric Unit Is Deposited As
3i9b (30s) And 3i9c (50s)
pdb|2X9S|Y Chain Y, Structure Of The 70s Ribosome Bound To Release Factor 2
And A Substrate Analog Provides Insights Into Catalysis
Of Peptide Release
pdb|2X9U|Y Chain Y, Structure Of The 70s Ribosome Bound To Release Factor 2
And A Substrate Analog Provides Insights Into Catalysis
Of Peptide Release
pdb|2XG0|Y Chain Y, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
70s Ribosome (Part 2 Of 4)
pdb|2XG2|Y Chain Y, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
70s Ribosome (Part 4 Of 4)
pdb|3OH5|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Chloramphenicol. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OH7|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Chloramphenicol. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OHJ|Y Chain Y, Structure Of The Thermus Thermophilus Ribosome Complexed
With Erythromycin. This File Contains The 50s Subunit
Of One 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes.
pdb|3OHK|Y Chain Y, Structure Of The Thermus Thermophilus Ribosome Complexed
With Erythromycin. This File Contains The 50s Subunit
Of One 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes.
pdb|3OHZ|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Azithromycin. This File Contains The 50s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI1|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Azithromycin. This File Contains The 50s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI3|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Telithromycin. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI5|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Telithromycin. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|2XQE|Y Chain Y, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The
70s Ribosome With A Gtp Analog
pdb|2XTG|Y Chain Y, Trna Tranlocation On The 70s Ribosome: The Pre-
Translocational Translocation Intermediate Ti(Pre)
pdb|2XUX|Y Chain Y, Trna Translocation On The 70s Ribosome: The Post-
Translocational Translocation Intermediate Ti(Post)
pdb|2Y0V|Y Chain Y, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
A Near-Cognate Codon On The 70s Ribosome
pdb|2Y0X|Y Chain Y, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
A Near-Cognate Codon On The 70s Ribosome
pdb|2Y0Z|Y Chain Y, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
To A Near-Cognate Codon On The 70s Ribosome
pdb|2Y11|Y Chain Y, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
A Cognate Codon On The 70s Ribosome.
pdb|2Y13|Y Chain Y, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
To A Near-Cognate Codon On The 70s Ribosome
pdb|2Y15|Y Chain Y, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
To A Cognate Codon On The 70s Ribosome.
pdb|2Y17|Y Chain Y, Ef-Tu Complex 3
pdb|2Y19|Y Chain Y, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
A Cognate Codon On The 70s Ribosome.
pdb|3ZVP|Y Chain Y, Crystal Structure Of The Hybrid State Of Ribosome In
Complex With The Guanosine Triphosphatase Release
Factor 3
pdb|3UXQ|Y Chain Y, The Structure Of Thermorubin In Complex With The 70s
Ribosome From Thermus Thermophilus. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3UXR|Y Chain Y, The Structure Of Thermorubin In Complex With The 70s
Ribosome From Thermus Thermophilus. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3UYE|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The
Near-Cognate Trna-Leu Complex
pdb|3UYG|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The
Near-Cognate Trna-Leu Complex
pdb|3UZ1|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The
Near-Cognate Trna-Leu Complex With Paromomycin
pdb|3UZ2|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The
Near-Cognate Trna-Leu Complex With Paromomycin.
pdb|3UZ8|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Tyr Complex.
pdb|3UZ9|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Tyr Complex.
pdb|3UZF|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The
Near-Cognate Trna-Tyr Complex
pdb|3UZH|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The
Near-Cognate Trna-Tyr Complex.
pdb|3UZK|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The
Near-Cognate Trna-Tyr Complex With Paromomycin
pdb|3UZN|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 50s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The
Near-cognate Trna-tyr Complex With Paromomycin
pdb|4ABS|Y Chain Y, Complex Of Smpb, A Tmrna Fragment And
Ef-Tu-Gdp-Kirromycin With The 70s Ribosome
pdb|4DHA|Y Chain Y, Crystal Structure Of Yaej Bound To The 70s Ribosome
pdb|4DHC|Y Chain Y, Crystal Structure Of Yaej Bound To The 70s Ribosome
pdb|3V23|Y Chain Y, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 1st Ribosome In The Asu
pdb|3V25|Y Chain Y, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 2nd Ribosome In The Asu
pdb|3V27|Y Chain Y, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 50s Subunit Of
The 1st Ribosome In The Asu
pdb|3V29|Y Chain Y, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
Entry Contains The 50s Subunit Of The 2nd Molecule In
The Asu.
pdb|3V2D|Y Chain Y, Crystal Structure Of Yfia Bound To The 70s Ribosome.
This Pdb Entry Contains Coordinates For The 50s Subunit
Of The 1st Ribosome In The Asu
pdb|3V2F|Y Chain Y, Crystal Structure Of Yfia Bound To The 70s Ribosome.
This Pdb Entry Contains Coordinates For The 50s Subunit
Of The 2nd Ribosome In The Asu
pdb|4G5L|U Chain U, Crystal Structure Of The 70s Ribosome With Tetracycline.
This Entry Contains The 50s Subunit Of Molecule A.
pdb|4G5N|U Chain U, Crystal Structure Of The 70s Ribosome With Tetracycline.
This Entry Contains The 50s Subunit Of Molecule B.
pdb|4G5U|U Chain U, Crystal Structure Of The 70s Ribosome With Tigecycline.
This Entry Contains The 50s Subunit Of Molecule A.
pdb|4G5W|U Chain U, Crystal Structure Of The 70s Ribosome With Tigecycline.
This Entry Contains The 50s Subunit Of Molecule B
Length = 110
Score = 28.5 bits (62), Expect = 0.98, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 17/29 (58%)
Query: 1 MSMSVRKDDEVQVVGGTYKGREGKFVQIF 29
+ M V+K D V V G YKGR GK ++
Sbjct: 3 VKMHVKKGDTVLVASGKYKGRVGKVKEVL 31
>pdb|3J21|U Chain U, Promiscuous Behavior Of Proteins In Archaeal Ribosomes
Revealed By Cryo-em: Implications For Evolution Of
Eukaryotic Ribosomes (50s Ribosomal Proteins)
Length = 121
Score = 28.5 bits (62), Expect = 0.98, Method: Compositional matrix adjust.
Identities = 12/27 (44%), Positives = 20/27 (74%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQI 28
++ VR D+V+++ G YKG EGK V++
Sbjct: 43 NLPVRVGDKVRIMRGDYKGHEGKVVEV 69
>pdb|3MRZ|U Chain U, Recognition Of The Amber Stop Codon By Release Factor
Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit.
The 30s Ribosomal Subunit Can Be Found In Pdb Entry
3ms0. Molecule A In The Same Asymmetric Unit Is
Deposited As 3mr8 (50s) And 3ms1 (30s).
pdb|3MS1|U Chain U, Recognition Of The Amber Stop Codon By Release Factor
Rf1. This Entry 3ms1 Contains 50s Ribosomal Subunit.
The 30s Ribosomal Subunit Can Be Found In Pdb Entry
3mr8. Molecule B In The Same Asymmetric Unit Is
Deposited As 3mrz (50s) And 3ms0 (30s)
Length = 109
Score = 28.5 bits (62), Expect = 0.98, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 17/29 (58%)
Query: 1 MSMSVRKDDEVQVVGGTYKGREGKFVQIF 29
+ M V+K D V V G YKGR GK ++
Sbjct: 2 VKMHVKKGDTVLVASGKYKGRVGKVKEVL 30
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound
pdb|1BI9|B Chain B, Retinal Dehydrogenase Type Two With Nad Bound
pdb|1BI9|C Chain C, Retinal Dehydrogenase Type Two With Nad Bound
pdb|1BI9|D Chain D, Retinal Dehydrogenase Type Two With Nad Bound
Length = 499
Score = 27.3 bits (59), Expect = 2.1, Method: Composition-based stats.
Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
Query: 15 GGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDP 49
GG GR+G F++ +FS V D+ ++ E IF P
Sbjct: 369 GGKGLGRKGFFIEP-TVFSNVTDDMRIAKEEIFGP 402
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase
From Sinorhizobium Meliloti
pdb|3U4J|B Chain B, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase
From Sinorhizobium Meliloti
pdb|3U4J|C Chain C, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase
From Sinorhizobium Meliloti
pdb|3U4J|D Chain D, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase
From Sinorhizobium Meliloti
Length = 528
Score = 26.9 bits (58), Expect = 2.9, Method: Composition-based stats.
Identities = 13/37 (35%), Positives = 19/37 (51%)
Query: 13 VVGGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDP 49
++GG GRE +F+GV D ++ E IF P
Sbjct: 370 LLGGERIGREAGLYYAPTVFAGVTPDXSIAREEIFGP 406
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin
pdb|1O9J|B Chain B, The X-Ray Crystal Structure Of Eta-Crystallin
pdb|1O9J|C Chain C, The X-Ray Crystal Structure Of Eta-Crystallin
pdb|1O9J|D Chain D, The X-Ray Crystal Structure Of Eta-Crystallin
Length = 501
Score = 26.6 bits (57), Expect = 3.6, Method: Composition-based stats.
Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
Query: 15 GGTYKGREGKFVQIFAIFSGVKRDLVVSYEPIFDP 49
GG G +G F+Q +FS V D+ ++ E IF P
Sbjct: 371 GGGPWGNKGYFIQP-TVFSNVTDDMRIAKEEIFGP 404
>pdb|2J28|U Chain U, Model Of E. Coli Srp Bound To 70s Rncs
pdb|3FIK|U Chain U, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
Consists Of The 50s Subunit.
pdb|2WWQ|U Chain U, E.Coli 70s Ribosome Stalled During Translation Of Tnac
Leader Peptide. This File Contains The 50s, The P-Site
Trna And The Tnac Leader Peptide (Part 2 Of 2).
pdb|3OFQ|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OFR|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 50s Subunit Of The
First 70s Ribosome With Erthromycin Bound.
pdb|3OFC|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 50s Subunit Of
The First 70s Ribosome With Chloramphenicol Bound.
pdb|3OFD|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 50s Subunit Of
The Second 70s Ribosome.
pdb|3OFZ|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 50s Subunit Of The
First 70s Ribosome Bound To Clindamycin.
pdb|3OG0|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OAS|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 50s Subunit Of
The Second 70s Ribosome.
pdb|3OAT|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 50s Subunit Of
The First 70s Ribosome With Telithromycin Bound.
pdb|3R8S|U Chain U, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
pdb|3R8T|U Chain U, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
pdb|3J19|U Chain U, Structure Of The Bacterial Ribosome Complexed By
Tmrna-Smpb And Ef-G During Translocation And
Mld-Loading (50s Subunit)
Length = 102
Score = 26.6 bits (57), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 11/29 (37%), Positives = 18/29 (62%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFA 30
+ +R+DDEV V+ G KG+ GK + +
Sbjct: 1 AAKIRRDDEVIVLTGKDKGKRGKVKNVLS 29
>pdb|1P85|S Chain S, Real Space Refined Coordinates Of The 50s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
State Of E. Coli 70s Ribosome
pdb|1P86|S Chain S, Real Space Refined Coordinates Of The 50s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The
Initiation-Like State Of E. Coli 70s Ribosome
pdb|2AW4|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File
Contains The 50s Subunit Of One 70s Ribosome. The
Entire Crystal Structure Contains Two 70s Ribosomes And
Is Described In Remark 400.
pdb|2AWB|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File
Contains The 50s Subunit Of The Second 70s Ribosome.
The Entire Crystal Structure Contains Two 70s Ribosomes
And Is Described In Remark 400.
pdb|2I2T|U Chain U, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described
In Remark 400.
pdb|2I2V|U Chain U, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described
In Remark 400.
pdb|2QOV|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 50s Subunit Of The First 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|2QOX|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 50s Subunit Of The Second 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|2QOZ|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 50s Subunit Of The
First 70s Ribosome, With Neomycin Bound. The Entire
Crystal Structure Contains Two 70s Ribosomes.
pdb|2QP1|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome, With Neomycin Bound. The Entire
Crystal Structure Contains Two 70s Ribosomes.
pdb|2QAM|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 50s Subunit Of The First 70s Ribosome,
With Neomycin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QAO|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 50s Subunit Of The Second 70s Ribosome,
With Neomycin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBA|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 50s Subunit Of The First 70s Ribosome,
With Gentamicin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBC|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 50s Subunit Of The Second 70s Ribosome,
With Gentamicin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBE|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 50s Subunit Of The
First 70s Ribosome, With Rrf Bound. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described
In Remark 400.
pdb|2QBG|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 50s Subunit Of The
Second 70s Ribosome, With Rrf Bound. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described
In Remark 400.
pdb|2QBI|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The First 70s Ribosome, With Gentamicin
And Rrf Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2QBK|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The Second 70s Ribosome, With Gentamicin
And Rrf Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2Z4L|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The First 70s Ribosome, With Paromomycin
And Rrf Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2Z4N|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The Second 70s Ribosome, With
Paromomycin And Rrf Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2VHM|U Chain U, Structure Of Pdf Binding Helix In Complex With The
Ribosome (Part 1 Of 4)
pdb|2VHN|U Chain U, Structure Of Pdf Binding Helix In Complex With The
Ribosome. (Part 2 Of 4)
pdb|2RDO|U Chain U, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
pdb|2VRH|C Chain C, Structure Of The E. Coli Trigger Factor Bound To A
Translating Ribosome
pdb|3DF2|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This
File Contains The 50s Subunit Of The First 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|3DF4|U Chain U, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This
File Contains The 50s Subunit Of The Second 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|3BBX|U Chain U, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
Map 50s.Nc-Trna.Hsp15 Complex
pdb|3J01|U Chain U, Structure Of The Ribosome-Secye Complex In The Membrane
Environment
pdb|3J0T|W Chain W, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class2 Of The Six
Classes)
pdb|3J0W|W Chain W, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 4a Of The Six
Classes)
pdb|3J0Y|W Chain W, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 4b Of The Six
Classes)
pdb|3J11|W Chain W, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 3 Of The Six
Classes)
pdb|3J12|W Chain W, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 5 Of The Six
Classes)
pdb|3J14|W Chain W, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 6 Of The Six
Classes)
Length = 103
Score = 26.6 bits (57), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 11/29 (37%), Positives = 18/29 (62%)
Query: 2 SMSVRKDDEVQVVGGTYKGREGKFVQIFA 30
+ +R+DDEV V+ G KG+ GK + +
Sbjct: 1 AAKIRRDDEVIVLTGKDKGKRGKVKNVLS 29
>pdb|4FCY|A Chain A, Crystal Structure Of The Bacteriophage Mu Transpososome
pdb|4FCY|B Chain B, Crystal Structure Of The Bacteriophage Mu Transpososome
Length = 529
Score = 26.2 bits (56), Expect = 5.3, Method: Composition-based stats.
Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
Query: 6 RKDDEVQVVGGTYKGREGKFVQIFAIFSGVKRDLVVSYEP 45
RK + VGG+ KG + + + + +GVK+ +VV ++P
Sbjct: 423 RKGEFTLKVGGSLKGAKNVYYNLALMLAGVKK-VVVRFDP 461
>pdb|2WYB|B Chain B, The Quorum Quenching N-Acyl Homoserine Lactone Acylase
Pvdq With A Covalently Bound Dodecanoic Acid
pdb|2WYC|B Chain B, The Quorum Quenching N-Acyl Homoserine Lactone Acylase
Pvdq In Complex With 3-Oxo-Lauric Acid
pdb|2WYD|B Chain B, The Quorum Quenching N-Acyl Homoserine Lactone Acylase
Pvdq In Complex With Dodecanoic Acid
pdb|2WYE|B Chain B, The Quorum Quenching N-Acyl Homoserine Lactone Acylase
Pvdq Is An Ntn-Hydrolase With An Unusual
Substrate-Binding Pocket
pdb|3L91|B Chain B, Structure Of Pseudomonas Aerugionsa Pvdq Bound To
Octanoate
pdb|3L94|B Chain B, Structure Of Pvdq Covalently Acylated With Myristate
pdb|3SRA|B Chain B, Structure Of Pseudomonas Aerugionsa Pvdq Covalently
Acylated With Myristic Acid From Pvdiq
pdb|3SRB|B Chain B, Structure Of Pseudomonas Aeruginosa Pvdq Bound To Smer28
pdb|3SRC|B Chain B, Structure Of Pseudomonas Aeruginosa Pvdq Bound To Ns2028
Length = 546
Score = 25.8 bits (55), Expect = 5.8, Method: Composition-based stats.
Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 7/50 (14%)
Query: 4 SVRKDDEVQVVGGTYKGREGKFVQIFAI-FSGVKRDLVVSYEPIFDPRIP 52
SVRK D ++VVGGT ++Q+ G K ++++ DPR P
Sbjct: 466 SVRKGDHLEVVGGT------SYIQLVTFPEEGPKARGLLAFSQSSDPRSP 509
>pdb|2GYA|S Chain S, Structure Of The 50s Subunit Of A Pre-Translocational E.
Coli Ribosome Obtained By Fitting Atomic Models For Rna
And Protein Components Into Cryo-Em Map Emd-1056
pdb|2GYC|S Chain S, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
Ribosome Complex Obtained By Fitting Atomic Models For
Rna And Protein Components Into Cryo-Em Map Emd-1143
Length = 99
Score = 25.8 bits (55), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 11/26 (42%), Positives = 17/26 (65%)
Query: 5 VRKDDEVQVVGGTYKGREGKFVQIFA 30
+R+DDEV V+ G KG+ GK + +
Sbjct: 2 IRRDDEVIVLTGKDKGKRGKVKNVLS 27
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.138 0.390
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,081,333
Number of Sequences: 62578
Number of extensions: 70656
Number of successful extensions: 123
Number of sequences better than 100.0: 24
Number of HSP's better than 100.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 103
Number of HSP's gapped (non-prelim): 24
length of query: 86
length of database: 14,973,337
effective HSP length: 54
effective length of query: 32
effective length of database: 11,594,125
effective search space: 371012000
effective search space used: 371012000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)