BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041741
(748 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2QFC|A Chain A, Crystal Structure Of Bacillus Thuringiensis Plcr Complexed
With Papr
pdb|2QFC|B Chain B, Crystal Structure Of Bacillus Thuringiensis Plcr Complexed
With Papr
pdb|3U3W|A Chain A, Crystal Structure Of Bacillus Thuringiensis Plcr In
Complex With The Peptide Papr7 And Dna
pdb|3U3W|B Chain B, Crystal Structure Of Bacillus Thuringiensis Plcr In
Complex With The Peptide Papr7 And Dna
Length = 293
Score = 32.0 bits (71), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 12/34 (35%), Positives = 25/34 (73%), Gaps = 2/34 (5%)
Query: 150 GLD--KNIYVANALLSLYAKCGWTKHAVPVFEEM 181
G+D +N+Y+ NA+ ++YA+ G+ K + +FE++
Sbjct: 148 GIDVYQNLYIENAIANIYAENGYLKKGIDLFEQI 181
>pdb|1N93|X Chain X, Crystal Structure Of The Borna Disease Virus Nucleoprotein
Length = 375
Score = 29.6 bits (65), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 18/59 (30%), Positives = 29/59 (49%)
Query: 606 DITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEML 664
D+T + I + SH + +GV I +S ++ G E I + M+ L R H A +L
Sbjct: 132 DLTELEISSIFSHCCSLLIGVVIGSSSKIKAGAEQIKKRFKTMMAALNRPSHGETATLL 190
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.134 0.403
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,373,668
Number of Sequences: 62578
Number of extensions: 867483
Number of successful extensions: 1899
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1893
Number of HSP's gapped (non-prelim): 6
length of query: 748
length of database: 14,973,337
effective HSP length: 106
effective length of query: 642
effective length of database: 8,340,069
effective search space: 5354324298
effective search space used: 5354324298
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)