BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041741
         (748 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QFC|A Chain A, Crystal Structure Of Bacillus Thuringiensis Plcr Complexed
           With Papr
 pdb|2QFC|B Chain B, Crystal Structure Of Bacillus Thuringiensis Plcr Complexed
           With Papr
 pdb|3U3W|A Chain A, Crystal Structure Of Bacillus Thuringiensis Plcr In
           Complex With The Peptide Papr7 And Dna
 pdb|3U3W|B Chain B, Crystal Structure Of Bacillus Thuringiensis Plcr In
           Complex With The Peptide Papr7 And Dna
          Length = 293

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 25/34 (73%), Gaps = 2/34 (5%)

Query: 150 GLD--KNIYVANALLSLYAKCGWTKHAVPVFEEM 181
           G+D  +N+Y+ NA+ ++YA+ G+ K  + +FE++
Sbjct: 148 GIDVYQNLYIENAIANIYAENGYLKKGIDLFEQI 181


>pdb|1N93|X Chain X, Crystal Structure Of The Borna Disease Virus Nucleoprotein
          Length = 375

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 606 DITFVAILTACSHSGLVDVGVEIFNSMQLDHGVEPILDHYTCMIDCLGRAGHFHEAEML 664
           D+T + I +  SH   + +GV I +S ++  G E I   +  M+  L R  H   A +L
Sbjct: 132 DLTELEISSIFSHCCSLLIGVVIGSSSKIKAGAEQIKKRFKTMMAALNRPSHGETATLL 190


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.134    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,373,668
Number of Sequences: 62578
Number of extensions: 867483
Number of successful extensions: 1899
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1893
Number of HSP's gapped (non-prelim): 6
length of query: 748
length of database: 14,973,337
effective HSP length: 106
effective length of query: 642
effective length of database: 8,340,069
effective search space: 5354324298
effective search space used: 5354324298
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)