Citrus Sinensis ID: 041751

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MAVVSRTASRLALTSPATPRPTLLHSTRCFSSSSYSPSPSPSSSPQPRATFGPVGLSKASEYVISKVDNLLNWVRRGSLWPMTFGLACCAVEMMHTGAAGYDLDRFGIIFRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSRANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKINRRRDFLHWWTK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccEEEEEcccccccccccccccEEccccCEccccEEcccccccHHHHHHHHHHHHHHHHHcccccccccc
*********************************************************KASEYVISKVDNLLNWVRRGSLWPMTFGLACCAVEMMHTGAAGYDLDRFGIIFRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSRANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKINRRRDFLHWWTK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVVSRTASRLALTSPATPRPTLLHSTRCFSSSSYSPSPSPSSSPQPRATFGPVGLSKASEYVISKVDNLLNWVRRGSLWPMTFGLACCAVEMMHTGAAGYDLDRFGIIFRPSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSRANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKINRRRDFLHWWTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ42577
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentP42026
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentP0CB83

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.99.-With other acceptors.probable
1.6.5.-With a quinone or similar compound as acceptor.probable
1.6.5.3NADH:ubiquinone reductase (H(+)-translocating).probable
1.6.99.3Transferred entry: 1.6.99.3.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I9V, chain 6
Confidence level:very confident
Coverage over the Query: 58-100,116-211
View the alignment between query and template
View the model in PyMOL