Query         041778
Match_columns 72
No_of_seqs    58 out of 60
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 10:32:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041778.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041778hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0916 1,3-beta-glucan syntha  98.2 4.9E-07 1.1E-11   80.9   2.1   48   24-72     11-59  (1679)
  2 KOG0917 Uncharacterized conser  62.5       3 6.6E-05   33.3   0.5   21   51-71     10-30  (338)
  3 PF00525 Crystallin:  Alpha cry  30.4      18 0.00039   22.5   0.1   23   33-55     26-48  (59)
  4 PRK10241 hydroxyacylglutathion  24.4      21 0.00045   25.7  -0.4   20   41-60    199-221 (251)
  5 TIGR03413 GSH_gloB hydroxyacyl  22.4      24 0.00051   25.3  -0.4   21   41-61    198-221 (248)
  6 PF06469 DUF1088:  Domain of Un  22.3      31 0.00068   25.2   0.2   10   54-63     12-21  (169)
  7 PF15201 Rod_cone_degen:  Progr  15.9      79  0.0017   19.4   0.9   13   57-69     18-30  (54)
  8 PLN02469 hydroxyacylglutathion  15.7      40 0.00087   24.6  -0.5   17   43-59    210-229 (258)
  9 PRK07742 phosphate butyryltran  10.6      99  0.0022   23.2   0.3   16   57-72    161-176 (299)
 10 PRK11183 D-lactate dehydrogena  10.5 1.2E+02  0.0026   25.8   0.8   20   42-61     41-60  (564)

No 1  
>KOG0916 consensus 1,3-beta-glucan synthase/callose synthase catalytic subunit [Cell wall/membrane/envelope biogenesis]
Probab=98.23  E-value=4.9e-07  Score=80.94  Aligned_cols=48  Identities=50%  Similarity=0.657  Sum_probs=38.6

Q ss_pred             hhhhhhcccCCCCCCcCCcccccccch-hhhhHHhhhcccccCCCccccC
Q 041778           24 QAQKMFVDVQDEDSSAIDSELVPSSLA-AIAPVLRVANQIEKDNPRVAYL   72 (72)
Q Consensus        24 r~~t~~v~~~~~~~~~~dSE~vPssl~-~I~piLRvAneiE~~~PRVAyL   72 (72)
                      |+.+++++.++.+ +.+|++.+|+++. +|+||||+||+||.+|||+|||
T Consensus        11 ~~~~~~~~~~~~~-~~~~~~~~~~s~~~~i~pilr~a~~i~~~~p~~a~l   59 (1679)
T KOG0916|consen   11 RSDDQTIYDGYEY-ESYDSSGLPSSLYDDIAPILRVANEIEQQNPRVAYL   59 (1679)
T ss_pred             hcchhhhccCCCC-CCCCcccCCcccccccchhhhccccccccCchhhhc
Confidence            3344444555655 5888888888888 5999999999999999999996


No 2  
>KOG0917 consensus Uncharacterized conserved protein [Function unknown]
Probab=62.50  E-value=3  Score=33.28  Aligned_cols=21  Identities=43%  Similarity=0.637  Sum_probs=20.4

Q ss_pred             hhhhHHhhhcccccCCCcccc
Q 041778           51 AIAPVLRVANQIEKDNPRVAY   71 (72)
Q Consensus        51 ~I~piLRvAneiE~~~PRVAy   71 (72)
                      .|+++||.|.|.++.+|-|||
T Consensus        10 si~~~l~~a~e~~k~dpvvay   30 (338)
T KOG0917|consen   10 SIQHHLRTAQEHDKRDPVVAY   30 (338)
T ss_pred             HHHHHHHHHHhhcccccHHHH
Confidence            799999999999999999998


No 3  
>PF00525 Crystallin:  Alpha crystallin A chain, N terminal;  InterPro: IPR003090 The crystallins are water-soluble structural proteins that occur in high concentration in the cytoplasm of eye lens fibre cells. Four major groups of crystallin have been distinguished on the basis of size, charge and immunological properties: alpha-, beta- and gamma-crystallins occur in all vertebrate classes (though gamma-crystallins are low or absent in avian lenses); and delta-crystallin is found exclusively in reptiles and birds [, ].  Alpha-crystallin occurs as large aggregates, comprising two types of related subunits (A and B) that are highly similar to the small (15-30kDa) heat shock proteins (HSPs), particularly in their C-terminal halves. The relationship between these families is one of classic gene duplication and divergence, from the small HSP family, allowing adaptation to novel functions. Divergence probably occurred prior to evolution of the eye lens, alpha-crystallin being found in small amounts in tissues outside the lens []. Alpha-crystallin has chaperone-like properties including the ability to prevent the precipitation of denatured proteins and to increase cellular tolerance to stress []. It has been suggested that these functions are important for the maintenance of lens transparency and the prevention of cataracts. This is supported by the observation that alpha-crystallin mutations show an association with cataract formation. This entry represents the N-terminal domain of alpha-crystallin. It is not necessary for dimerisation or chaperone activity, but appears to be required for the formation of higher order aggregates [, ].; GO: 0005212 structural constituent of eye lens; PDB: 2YGD_P.
Probab=30.37  E-value=18  Score=22.48  Aligned_cols=23  Identities=35%  Similarity=0.540  Sum_probs=13.5

Q ss_pred             CCCCCCcCCcccccccchhhhhH
Q 041778           33 QDEDSSAIDSELVPSSLAAIAPV   55 (72)
Q Consensus        33 ~~~~~~~~dSE~vPssl~~I~pi   55 (72)
                      +++|+-.+|+|++|.+...+.|+
T Consensus        26 Q~FGEgL~d~DLf~~~~s~lsp~   48 (59)
T PF00525_consen   26 QNFGEGLFDSDLFPSSSSTLSPY   48 (59)
T ss_dssp             TTSEESSTTTT---BT-TCSS--
T ss_pred             HhhccccCHhhhccccccccCcc
Confidence            78888899999999984444443


No 4  
>PRK10241 hydroxyacylglutathione hydrolase; Provisional
Probab=24.41  E-value=21  Score=25.69  Aligned_cols=20  Identities=25%  Similarity=0.351  Sum_probs=15.8

Q ss_pred             Ccccccccch-h--hhhHHhhhc
Q 041778           41 DSELVPSSLA-A--IAPVLRVAN   60 (72)
Q Consensus        41 dSE~vPssl~-~--I~piLRvAn   60 (72)
                      +-..||++|+ |  |-||||+-+
T Consensus       199 ~~~t~pstl~~E~~~Npflr~~~  221 (251)
T PRK10241        199 NQITLPVILKNERQINLFLRTED  221 (251)
T ss_pred             CCCcCCccHHHHHhhCCeecCCC
Confidence            3467999999 3  999999754


No 5  
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753).
Probab=22.40  E-value=24  Score=25.27  Aligned_cols=21  Identities=29%  Similarity=0.531  Sum_probs=16.4

Q ss_pred             Ccccccccch-h--hhhHHhhhcc
Q 041778           41 DSELVPSSLA-A--IAPVLRVANQ   61 (72)
Q Consensus        41 dSE~vPssl~-~--I~piLRvAne   61 (72)
                      +-..+|++|+ |  +-||||+-+.
T Consensus       198 ~~~t~pstl~~E~~~Npflr~~~~  221 (248)
T TIGR03413       198 GQPTLPSTLGLERATNPFLRADDP  221 (248)
T ss_pred             CCCCCCccHHHHHhhCCeecCCCH
Confidence            3467999999 3  9999997543


No 6  
>PF06469 DUF1088:  Domain of Unknown Function (DUF1088);  InterPro: IPR010508 This domain is found in the neurobeachins. The function of this region is not known.
Probab=22.26  E-value=31  Score=25.21  Aligned_cols=10  Identities=50%  Similarity=0.753  Sum_probs=8.0

Q ss_pred             hHHhhhcccc
Q 041778           54 PVLRVANQIE   63 (72)
Q Consensus        54 piLRvAneiE   63 (72)
                      =|+|||||-|
T Consensus        12 HivRVAnEAe   21 (169)
T PF06469_consen   12 HIVRVANEAE   21 (169)
T ss_pred             HHHHHhHHHH
Confidence            3899999865


No 7  
>PF15201 Rod_cone_degen:  Progressive rod-cone degeneration
Probab=15.86  E-value=79  Score=19.36  Aligned_cols=13  Identities=31%  Similarity=0.547  Sum_probs=10.4

Q ss_pred             hhhcccccCCCcc
Q 041778           57 RVANQIEKDNPRV   69 (72)
Q Consensus        57 RvAneiE~~~PRV   69 (72)
                      |.||.||+|--+|
T Consensus        18 rfanrvqpeps~v   30 (54)
T PF15201_consen   18 RFANRVQPEPSGV   30 (54)
T ss_pred             HHhccCCCCCCCC
Confidence            7899999986654


No 8  
>PLN02469 hydroxyacylglutathione hydrolase
Probab=15.72  E-value=40  Score=24.62  Aligned_cols=17  Identities=35%  Similarity=0.649  Sum_probs=14.3

Q ss_pred             ccccccch-h--hhhHHhhh
Q 041778           43 ELVPSSLA-A--IAPVLRVA   59 (72)
Q Consensus        43 E~vPssl~-~--I~piLRvA   59 (72)
                      ..||++|. |  +-||||+.
T Consensus       210 ~t~pstl~~E~~~Npflr~~  229 (258)
T PLN02469        210 PTVPSTIEEELETNPFMRVD  229 (258)
T ss_pred             CcCCccHHHHHhhCCeecCC
Confidence            56899999 3  99999974


No 9  
>PRK07742 phosphate butyryltransferase; Validated
Probab=10.61  E-value=99  Score=23.16  Aligned_cols=16  Identities=50%  Similarity=0.544  Sum_probs=12.2

Q ss_pred             hhhcccccCCCccccC
Q 041778           57 RVANQIEKDNPRVAYL   72 (72)
Q Consensus        57 RvAneiE~~~PRVAyL   72 (72)
                      ..|+.+.-++||||.|
T Consensus       161 ~~a~~lGie~PkVAlL  176 (299)
T PRK07742        161 EVARAIGIDLPKVAPL  176 (299)
T ss_pred             HHHHHhCCCCCeEEEE
Confidence            5666676678999976


No 10 
>PRK11183 D-lactate dehydrogenase; Provisional
Probab=10.52  E-value=1.2e+02  Score=25.83  Aligned_cols=20  Identities=20%  Similarity=0.315  Sum_probs=17.6

Q ss_pred             cccccccchhhhhHHhhhcc
Q 041778           42 SELVPSSLAAIAPVLRVANQ   61 (72)
Q Consensus        42 SE~vPssl~~I~piLRvAne   61 (72)
                      -=+.|.+..++.-|||+|++
T Consensus        41 AVV~P~SteEVa~IVklC~e   60 (564)
T PRK11183         41 AVVFPGTLLELWRVLQACVA   60 (564)
T ss_pred             EEEecCCHHHHHHHHHHHHH
Confidence            34789999999999999986


Done!