Query         041780
Match_columns 422
No_of_seqs    163 out of 379
Neff          5.9 
Searched_HMMs 46136
Date          Fri Mar 29 10:34:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041780.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041780hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03080 DUF239:  Domain of unk 100.0 4.7E-83   1E-87  612.6  25.2  225  186-415     1-229 (229)
  2 PF14365 DUF4409:  Domain of un 100.0 1.2E-39 2.5E-44  282.6   7.1  117   48-181     1-117 (117)
  3 PF07653 SH3_2:  Variant SH3 do  67.2     9.1  0.0002   28.2   3.9   37  278-319    15-51  (55)
  4 PF14604 SH3_9:  Variant SH3 do  40.7      48   0.001   24.0   3.9   21  298-319    27-47  (49)
  5 PF00018 SH3_1:  SH3 domain;  I  34.8      71  0.0015   22.6   3.9   24  293-317    24-48  (48)
  6 PF13956 Ibs_toxin:  Toxin Ibs,  31.3      28  0.0006   20.8   1.0   14    1-14      1-14  (19)
  7 PHA03072 putative viral membra  27.8      84  0.0018   29.6   4.0   25   31-63     81-106 (190)
  8 PF13987 YedD:  YedD-like prote  22.9      35 0.00076   29.3   0.6   23   39-61     22-45  (111)
  9 PF03356 Pox_LP_H2:  Viral late  22.6 1.2E+02  0.0026   28.6   4.0   25   31-63     81-106 (189)
 10 PHA02677 hypothetical protein;  20.0      93   0.002   26.9   2.5   16    5-20      2-17  (108)

No 1  
>PF03080 DUF239:  Domain of unknown function (DUF239);  InterPro: IPR004314 This is a family of plant proteins, a small number of which are putative peptidases (see for example Q9XIN9 from SWISSPROT). However, the structure of the protein PDB3:3eu8 has an alpha-alpha toroid fold and is similar to a glucoamylase, PDB:1ayx. Such glucoamylases are involved in breaking down complex sugars (e.g. starch). The biologically relevant state is likely to be monomeric. The putative active site is located at the centre of the toroid with a well defined large cavity. Further structural comparisons also show relationships with other glycohydrolases.
Probab=100.00  E-value=4.7e-83  Score=612.56  Aligned_cols=225  Identities=46%  Similarity=0.912  Sum_probs=214.4

Q ss_pred             EeeeEEEEeeecCCcCCCCCceeEEEEeccCC-CCCcceEEEEEEEcccccCCCceEEEEEEeecCcccCcccCCCCCce
Q 041780          186 YIGAQGDINVWNPRVESPDDYTTAQIWLKGGP-GDNFESVEGGWVVNPKLYGDKLTRLFVYWTKDSYKSTGCFDAICSGF  264 (422)
Q Consensus       186 ~~Ga~a~inV~~p~v~~~~q~S~sqiwv~~g~-~~~~n~IeaGW~V~P~lYgD~~~rlf~yWt~d~y~~tGCyNl~CpGF  264 (422)
                      |||++|+||||+|+|+.++|||++||||++++ .+.+|+|||||+|+|+||||++||||+|||+|+|++||||||+||||
T Consensus         1 y~G~~a~i~v~~p~v~~~~q~S~~~i~i~~g~~~~~~~~i~~GW~V~P~lygd~~~~lf~~wt~d~~~~tgCyN~~CpGF   80 (229)
T PF03080_consen    1 YYGARATISVWNPKVQQPDQFSLSQIWISNGSDDDSLNSIEAGWQVYPSLYGDSRTRLFVYWTADGYQKTGCYNLDCPGF   80 (229)
T ss_pred             CeeeEEEEECcCCccCCccceeheeEEEEecCCCCCCcEEEEeeeccccccCCCceEEEEEEEccCCCCcceeCCCCCcE
Confidence            79999999999999997779999999999999 78899999999999999999999999999999999999999999999


Q ss_pred             EEecc-cccCccccccccCCCceeEEeEEEEEecCCCCeEEEecCceeeeeecchhchhcccCceEEEEeeEEecCCCCC
Q 041780          265 VQTGQ-VALGAAIGPWSISEGPQYYLPVGIYLDPNTKNWWLKVNGNIVVGYWPGSLFSYLSYSAILVEWGGQVYSPNVKK  343 (422)
Q Consensus       265 VQvs~-i~lG~~i~pvS~~~G~q~~i~i~I~kD~~tgnWWL~~~~~~~IGYwP~sLF~~l~~~A~~V~wGGeV~~~~~~~  343 (422)
                      ||+++ |+||++|+|+|+++|+|++|+|+|+||+.+|||||+++++ .|||||++||++|+++|+.|+|||||++++   
T Consensus        81 Vq~s~~i~~G~~~~~~S~~gG~q~~i~~~i~kD~~~gnWWL~~~~~-~IGYwP~sLF~~l~~~A~~v~wGGeV~~~~---  156 (229)
T PF03080_consen   81 VQVSSSIALGAAISPVSTYGGKQYEITLSIFKDPKSGNWWLYYGGE-PIGYWPKSLFTSLADGATEVEWGGEVYSPP---  156 (229)
T ss_pred             EEeCCccccceeeCCCccCCCceEEEEEEEEecCCCccEEEEEecc-eeeeehHHhhhhhhcCceEEEEEEEEeCCC---
Confidence            99999 9999999999999999999999999999999999999886 899999999999999999999999999985   


Q ss_pred             CCCCCCCCCCCcCCCCCCCccEEEeecEEEcCCCCccCCC--cceecccCCcceeEeecccCcCcCCeEEEeCC
Q 041780          344 TPHTKTAMGSGSFSHGLQGSACSIEHVRIIDFSLQLKYPQ--WVGTWADEYYCYDAYNYVKGYTTEPVFFFGGP  415 (422)
Q Consensus       344 ~~~~sp~MGSG~fp~~g~~~Aay~~ni~ivd~~~~~~~p~--~~~~~~d~~~CY~v~~~~~~~~~g~~f~yGGP  415 (422)
                      ++|++|||||||||++++++|||||||+++|.++....+.  .+++++|+|+||++..... .+||.+||||||
T Consensus       157 ~~~~sppMGSG~fp~~g~~~aAy~~~i~~~d~~~~~~~~~~~~~~~~~~~~~CY~~~~~~~-~~~g~~f~yGGP  229 (229)
T PF03080_consen  157 GRHTSPPMGSGHFPSEGFGKAAYFRNIQVVDSNGQFVDPNDDLLEVFADNPSCYDVSYIGD-GDWGYYFFYGGP  229 (229)
T ss_pred             CCCCCCCccCCcCCCCCCCccEEEEEEEEEcCCCCCcCCcccceeEccCCCCceeEeeccC-CCcccEEEeeCC
Confidence            3589999999999999999999999999999999888774  4778999999999998733 679999999999


No 2  
>PF14365 DUF4409:  Domain of unknown function (DUF4409)
Probab=100.00  E-value=1.2e-39  Score=282.56  Aligned_cols=117  Identities=45%  Similarity=0.716  Sum_probs=94.0

Q ss_pred             eEEcCCCCeEeeeecCCCCCCCCCCCCCCCccCCCCCCCCcccccccccCCCCccceeecccCCCCCCCceeeeecChhh
Q 041780           48 SIKSEDGDIIDCVDIYKQPALDHPALKNHTIQLSPSFDIPAEKVDRRNESSRLPVTIQTWQKSGSCPNGTVPIRRIRRQD  127 (422)
Q Consensus        48 si~s~dGdiiDCVdi~kQPAfdHPlLKnH~iQ~~Ps~~p~~~~~~~~~~~~~~~~~~q~w~~~~~CP~GTVPIrR~t~~d  127 (422)
                      ||+|+||||||||||||||||||||||  +|||+|++.|+..... ...+..+...+|+|+++++||+|||||||+++||
T Consensus         1 tI~s~dGdi~DCVdi~kQPAfdHPlLK--~~q~~Ps~~p~~~~~~-~~~~~~~~~~~q~w~~~g~CP~GTVPIrRtt~~d   77 (117)
T PF14365_consen    1 TIQSPDGDIIDCVDIYKQPAFDHPLLK--NIQMRPSSYPKGISSK-ESSSSSSKPISQLWHQNGSCPEGTVPIRRTTKED   77 (117)
T ss_pred             CccCCCCCeEeCEeccccccccCchhc--CcccCcchhhhhcccc-cccccccccchhhhccccCCcCCceeeecCCHHH
Confidence            699999999999999999999999999  4779999999865432 1123345678999999999999999999999999


Q ss_pred             hhhhhhhhhcCCCCCccccccccccccCCccccccccccccCCCCCceEEEEEE
Q 041780          128 LLRASSLQQFGRKVPEVSYAANRTDATHSKFESINNKTIHLGPLVDRSAAVLVT  181 (422)
Q Consensus       128 l~ra~s~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~A~~~~  181 (422)
                      |+||+|+.+||+|.+..++   ......++           ....|||||++++
T Consensus        78 llr~~s~~~~g~k~~~~~~---~~~~~~~~-----------~~~~gH~~Aia~~  117 (117)
T PF14365_consen   78 LLRAKSFKRFGRKPPSSIS---SPSSNKPD-----------ISSNGHEHAIAYV  117 (117)
T ss_pred             HhhhhhHHHcCCcCCCCcC---CccccCCC-----------CCCCCCceEEEeC
Confidence            9999999999999886543   11111111           1247999999984


No 3  
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=67.16  E-value=9.1  Score=28.22  Aligned_cols=37  Identities=24%  Similarity=0.617  Sum_probs=24.2

Q ss_pred             ccccCCCceeEEeEEEEEecCCCCeEEEecCceeeeeecchh
Q 041780          278 PWSISEGPQYYLPVGIYLDPNTKNWWLKVNGNIVVGYWPGSL  319 (422)
Q Consensus       278 pvS~~~G~q~~i~i~I~kD~~tgnWWL~~~~~~~IGYwP~sL  319 (422)
                      ++|.--|..    |.|.++...++||+-..++ ..||.|++.
T Consensus        15 ~Ls~~~Gd~----i~v~~~~~~~~ww~~~~~g-~~G~~P~~~   51 (55)
T PF07653_consen   15 ELSFKKGDV----IEVLGEKDDDGWWLGENNG-RRGWFPSSY   51 (55)
T ss_dssp             B-EB-TTEE----EEEEEEECSTSEEEEEETT-EEEEEEGGG
T ss_pred             ceEEecCCE----EEEEEeecCCCEEEEEECC-cEEEEcHHH
Confidence            345555553    3344677788999876654 689999975


No 4  
>PF14604 SH3_9:  Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A ....
Probab=40.70  E-value=48  Score=24.01  Aligned_cols=21  Identities=24%  Similarity=0.752  Sum_probs=16.2

Q ss_pred             CCCCeEEEecCceeeeeecchh
Q 041780          298 NTKNWWLKVNGNIVVGYWPGSL  319 (422)
Q Consensus       298 ~tgnWWL~~~~~~~IGYwP~sL  319 (422)
                      ...+||+--.+. ..||+|++-
T Consensus        27 ~~~~W~~g~~~g-~~G~~P~~y   47 (49)
T PF14604_consen   27 SDDGWWYGRNTG-RTGLFPANY   47 (49)
T ss_dssp             SSTSEEEEEETT-EEEEEEGGG
T ss_pred             CCCCEEEEEECC-EEEEECHHh
Confidence            588899876544 799999874


No 5  
>PF00018 SH3_1:  SH3 domain;  InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. The crystal structure of the SH3 domain of the cytoskeletal protein spectrin, and the solution structures of SH3 domains of phospholipase C (PLC-y) and phosphatidylinositol 3-kinase p85 alpha-subunit, have been determined [, , ]. In spite of relatively limited sequence similarity, their overall structures are similar. The domains belong to the alpha+beta structural class, with 5 to 8 beta-strands forming 2 tightly-packed, anti-parallel beta-sheets arranged in a barrel-like structure, and intervening loops sometimes forming helices. Conserved aliphatic and aromatic residues form a hydrophobic core (A11, L23, A29, V34, W42, L52 and V59 in PLC-y []) and a hydrophobic pocket on the molecular surface (L12, F13, W53 and P55 in PLC-y). The conserved core is believed to stabilise the fold, while the pocket is thought to serve as a binding site for target proteins. Conserved carboxylic amino acids located in the loops, on the periphery of the pocket (D14 and E22), may be involved in protein-protein interactions via proline-rich regions. The N- and C-termini are packed in close proximity, indicating that they are independent structural modules.; GO: 0005515 protein binding; PDB: 1UHF_A 1W1F_A 1WA7_A 1SEM_A 1KFZ_A 2SEM_B 1K76_A 3SEM_B 1X2Q_A 2J06_B ....
Probab=34.76  E-value=71  Score=22.63  Aligned_cols=24  Identities=21%  Similarity=0.516  Sum_probs=15.5

Q ss_pred             EEEecCCCCeEEEecCc-eeeeeecc
Q 041780          293 IYLDPNTKNWWLKVNGN-IVVGYWPG  317 (422)
Q Consensus       293 I~kD~~tgnWWL~~~~~-~~IGYwP~  317 (422)
                      |.++ .+.+||+-.... ...||.|+
T Consensus        24 v~~~-~~~~Ww~~~~~~~~~~G~vP~   48 (48)
T PF00018_consen   24 VLEK-SDDGWWKVRNESTGKEGWVPS   48 (48)
T ss_dssp             EEEE-SSSSEEEEEETTTTEEEEEEG
T ss_pred             EEEe-cCCCEEEEEECCCCcEEEeeC
Confidence            3444 344899876543 36999996


No 6  
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=31.26  E-value=28  Score=20.78  Aligned_cols=14  Identities=29%  Similarity=0.375  Sum_probs=8.9

Q ss_pred             CcchhhHHHHHHHH
Q 041780            1 MEKTVYLFLLFGAI   14 (422)
Q Consensus         1 ~~~~~~~~~~~~~~   14 (422)
                      |+|.+.++++|+++
T Consensus         1 MMk~vIIlvvLLli   14 (19)
T PF13956_consen    1 MMKLVIILVVLLLI   14 (19)
T ss_pred             CceehHHHHHHHhc
Confidence            67777666665544


No 7  
>PHA03072 putative viral membrane protein; Provisional
Probab=27.77  E-value=84  Score=29.62  Aligned_cols=25  Identities=32%  Similarity=0.422  Sum_probs=15.9

Q ss_pred             hHHHHH-HHHhcCCcccceEEcCCCCeEeeeecC
Q 041780           31 LPEIDR-KLKLLNRPAVKSIKSEDGDIIDCVDIY   63 (422)
Q Consensus        31 ~~ei~~-~L~~lNkp~vksi~s~dGdiiDCVdi~   63 (422)
                      .+|.+| +++.++++.+-+        |-|||+=
T Consensus        81 ~iEsdrGr~~~~~r~d~f~--------F~CvDFG  106 (190)
T PHA03072         81 KLESDRGRLLAAGRDDLFE--------FNCVDFG  106 (190)
T ss_pred             HHHhhhhhHhhcCCccceE--------EEeeecc
Confidence            335555 566667665544        7899984


No 8  
>PF13987 YedD:  YedD-like protein
Probab=22.93  E-value=35  Score=29.33  Aligned_cols=23  Identities=35%  Similarity=0.703  Sum_probs=17.1

Q ss_pred             HhcCCcccce-EEcCCCCeEeeee
Q 041780           39 KLLNRPAVKS-IKSEDGDIIDCVD   61 (422)
Q Consensus        39 ~~lNkp~vks-i~s~dGdiiDCVd   61 (422)
                      +++..-|+.| |-|.+||..||--
T Consensus        22 ~lvSpeAiASLivt~~GdTLDCRQ   45 (111)
T PF13987_consen   22 ALVSPEAIASLIVTKEGDTLDCRQ   45 (111)
T ss_pred             cccChhheeEEEEccCCCccchhh
Confidence            3455566655 7899999999954


No 9  
>PF03356 Pox_LP_H2:  Viral late protein H2;  InterPro: IPR005023 This entry represents the late protein H2 found in Vaccinia and other poxviruses. This protein is a highly conserved viral membrane protein found in all sequenced poxviruses, containing an N-terminal transmembrane domain and four conserved cysteines thought to be involved in the formation of intramolecular disulphide bonds []. H2 has been shown to be necessary for entry into the host cell and virus-induced cell-cell fusion, but is not required for virus morphogenesis or the attachment of virus particles to cells. It is part of an entry-fusion complex composed of eight viral membrane proteins [].
Probab=22.62  E-value=1.2e+02  Score=28.61  Aligned_cols=25  Identities=36%  Similarity=0.488  Sum_probs=16.3

Q ss_pred             hHHHHH-HHHhcCCcccceEEcCCCCeEeeeecC
Q 041780           31 LPEIDR-KLKLLNRPAVKSIKSEDGDIIDCVDIY   63 (422)
Q Consensus        31 ~~ei~~-~L~~lNkp~vksi~s~dGdiiDCVdi~   63 (422)
                      .+|.+| +++.++++.+-+        |-|||+=
T Consensus        81 ~iEsdrGr~~~~~r~d~f~--------F~CvDFG  106 (189)
T PF03356_consen   81 KIESDRGRLLALGRDDLFE--------FNCVDFG  106 (189)
T ss_pred             HHHhhhhhHhhcCcccceE--------EEeeecc
Confidence            336665 666667665554        7799974


No 10 
>PHA02677 hypothetical protein; Provisional
Probab=19.96  E-value=93  Score=26.86  Aligned_cols=16  Identities=25%  Similarity=0.330  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHhhhcc
Q 041780            5 VYLFLLFGAISTLCNG   20 (422)
Q Consensus         5 ~~~~~~~~~~~~~~~~   20 (422)
                      .++||+||.|+++++.
T Consensus         2 itLFLilCYFILIFNI   17 (108)
T PHA02677          2 ISLFLIICYFVLIFNI   17 (108)
T ss_pred             eeeHHHHHHHHHHHHH
Confidence            3578899988888865


Done!