BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041794
         (790 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|A8MQY1|NAC68_ARATH NAC domain-containing protein 68 OS=Arabidopsis thaliana GN=NAC68
           PE=1 SV=1
          Length = 473

 Score = 33.1 bits (74), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 9/56 (16%)

Query: 680 RNCPDPSSLSKSISDMTEEVVNHRKFGIVNQIHHAVSMPRNHSMESSVPAEKDGLF 735
           + C DPS +S+ I ++T+EV          +I  AV  P N+   S V  EK GLF
Sbjct: 385 QTCTDPSIISREIRELTQEV--------KQEIPRAVDAPMNNE-SSLVKTEKKGLF 431


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.138    0.448 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 331,871,691
Number of Sequences: 539616
Number of extensions: 15154395
Number of successful extensions: 27806
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 27806
Number of HSP's gapped (non-prelim): 3
length of query: 790
length of database: 191,569,459
effective HSP length: 126
effective length of query: 664
effective length of database: 123,577,843
effective search space: 82055687752
effective search space used: 82055687752
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)