BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041794
(790 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|A8MQY1|NAC68_ARATH NAC domain-containing protein 68 OS=Arabidopsis thaliana GN=NAC68
PE=1 SV=1
Length = 473
Score = 33.1 bits (74), Expect = 9.8, Method: Compositional matrix adjust.
Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 9/56 (16%)
Query: 680 RNCPDPSSLSKSISDMTEEVVNHRKFGIVNQIHHAVSMPRNHSMESSVPAEKDGLF 735
+ C DPS +S+ I ++T+EV +I AV P N+ S V EK GLF
Sbjct: 385 QTCTDPSIISREIRELTQEV--------KQEIPRAVDAPMNNE-SSLVKTEKKGLF 431
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.321 0.138 0.448
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 331,871,691
Number of Sequences: 539616
Number of extensions: 15154395
Number of successful extensions: 27806
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 27806
Number of HSP's gapped (non-prelim): 3
length of query: 790
length of database: 191,569,459
effective HSP length: 126
effective length of query: 664
effective length of database: 123,577,843
effective search space: 82055687752
effective search space used: 82055687752
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)