BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041836
(574 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2C6X|A Chain A, Structure Of Bacillus Subtilis Citrate Synthase
pdb|2C6X|B Chain B, Structure Of Bacillus Subtilis Citrate Synthase
pdb|2C6X|C Chain C, Structure Of Bacillus Subtilis Citrate Synthase
pdb|2C6X|D Chain D, Structure Of Bacillus Subtilis Citrate Synthase
Length = 363
Score = 29.3 bits (64), Expect = 5.5, Method: Compositional matrix adjust.
Identities = 14/41 (34%), Positives = 24/41 (58%)
Query: 522 NSKEFSAKPPQKSSGNLLSKVKQSLGKVKKAIVGKSPSSKT 562
N+ FSA+ + +L+S V +LG +K + G +PS+ T
Sbjct: 180 NASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVT 220
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.296 0.117 0.294
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,220,420
Number of Sequences: 62578
Number of extensions: 475353
Number of successful extensions: 807
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 16
Number of HSP's that attempted gapping in prelim test: 797
Number of HSP's gapped (non-prelim): 27
length of query: 574
length of database: 14,973,337
effective HSP length: 104
effective length of query: 470
effective length of database: 8,465,225
effective search space: 3978655750
effective search space used: 3978655750
T: 11
A: 40
X1: 17 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 44 (21.9 bits)
S2: 54 (25.4 bits)