BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041836
         (574 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2C6X|A Chain A, Structure Of Bacillus Subtilis Citrate Synthase
 pdb|2C6X|B Chain B, Structure Of Bacillus Subtilis Citrate Synthase
 pdb|2C6X|C Chain C, Structure Of Bacillus Subtilis Citrate Synthase
 pdb|2C6X|D Chain D, Structure Of Bacillus Subtilis Citrate Synthase
          Length = 363

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 522 NSKEFSAKPPQKSSGNLLSKVKQSLGKVKKAIVGKSPSSKT 562
           N+  FSA+    +  +L+S V  +LG +K  + G +PS+ T
Sbjct: 180 NASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVT 220


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.296    0.117    0.294 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,220,420
Number of Sequences: 62578
Number of extensions: 475353
Number of successful extensions: 807
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 16
Number of HSP's that attempted gapping in prelim test: 797
Number of HSP's gapped (non-prelim): 27
length of query: 574
length of database: 14,973,337
effective HSP length: 104
effective length of query: 470
effective length of database: 8,465,225
effective search space: 3978655750
effective search space used: 3978655750
T: 11
A: 40
X1: 17 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 44 (21.9 bits)
S2: 54 (25.4 bits)