Citrus Sinensis ID: 041849

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MDLLSVSSTSTSHLHFSLYKPPNFSLSKSLPLSFKPISSVKTRRISTKTLALQQQQRQHDVPLSSAPQTPATAMRGAEADAMGLLLKERIVFLGNNIDDFVADAIISQLLLLDAQDPTKDIRLFVNSPGGSLSATMAIYDVVQLVRADVSTVALGMSASTASLILGGGTKGKRFAMPNTRVMIHQPMGGASGQVLDVEIQAREIMHNKDNFTRIISGFTGRSFEQVQKDIDRDRYMSPIEAVEYGIIDGVIDRDSIIPLVPVPEKVKPGFDYLEVRKDPRKFLTPDVPDDEIV
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccCEEcccccccHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEccccccHHcHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHcccccEECcccccccccccccccccccccHHHcccccccccccccccccc
**************************************************************LSSAPQTPATAMRGAEADAMGLLLKERIVFLGNNIDDFVADAIISQLLLLDAQDPTKDIRLFVNSPGGSLSATMAIYDVVQLVRADVSTVALGMSASTASLILGGGTKGKRFAMPNTRVMIHQPMGGASGQVLDVEIQAREIMHNKDNFTRIISGFTGRSFEQVQKDIDRDRYMSPIEAVEYGIIDGVIDRDS**************FDYLEVRKDPRKFLTPD*P****V
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLLSVSSTSTSHLHFSLYKPPNFSLSKSLPLSFKPISSVKTRRISTKTLALQQQQRQHDVPLSSAPQTPATAMRGAEADAMGLLLKERIVFLGNNIDDFVADAIISQLLLLDAQDPTKDIRLFVNSPGGSLSATMAIYDVVQLVRADVSTVALGMSASTASLILGGGTKGKRFAMPNTRVMIHQPMGGASGQVLDVEIQAREIMHNKDNFTRIISGFTGRSFEQVQKDIDRDRYMSPIEAVEYGIIDGVIDRDSIIPLVPVPEKVKPGFDYLEVRKDPRKFLTPDVPDDEIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease proteolytic subunit 4, chloroplastic Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). Essential protein required for chloroplast development and integrity.probableQ94B60
ATP-dependent Clp protease proteolytic subunit Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ4L4J5
ATP-dependent Clp protease proteolytic subunit Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableA8Z045

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.21.-Serine endopeptidases.probable
3.4.21.92Endopeptidase Clp.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P2L, chain A
Confidence level:very confident
Coverage over the Query: 66-256
View the alignment between query and template
View the model in PyMOL