Citrus Sinensis ID: 041864

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MMDQGVVVHEKNEARAFMAGVEGVTAKGDKSTRFGSDPIRASGSSLDLVAAVTSALGANINRKKRMARQRRSSSFNLLAFSSPSSSSTSHVSPPLALPAREIDPGRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPVLESKEGIFISMEDLDGLHVWTFKYRFWPNNNSRMYVLENTGDFVNAHGLQLGDFIIVYKDDQNQNYVIQAKKASDQDVYTNLTSDSVNDILLNDYEVNRSGSFYVNHPMAGEDTGMSFIYDTTTFSNDSPLDFLGGSLTSYSRIGQESFGSVENISLDDFY
cccccccccccccHHHHHcccccECccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccEEEcHHHHHHcccccccccccEEEEECccccEEEEEEEEEcccccccEEEEccHHHHHHHcccccccEEEEEEccccccEEEEEEEcccccccccccccccccccccccccccccccCCcccccccccccEEEEccccccccccccccccccccccccccccccccccccccccc
***********NEARAFMAG****************************VAAV******************************************************LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPVLESKEGIFISMEDLDGLHVWTFKYRFWPNNNSRMYVLENTGDFVNAHGLQLGDFIIVYKDDQNQNYVIQAKKASD***************LLNDYEVNRSGSFYVNHPMAGEDTGMSFIYDTTTFSNDSPLDFLGGSLTSYSR******GSVENISLDDFY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDQGVVVHEKNEARAFMAGVEGVTAKGDKSTRFGSDPIRASGSSLDLVAAVTSALGANINRKKRMARQRRSSSFNLLAFSSPSSSSTSHVSPPLALPAREIDPGRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPVLESKEGIFISMEDLDGLHVWTFKYRFWPNNNSRMYVLENTGDFVNAHGLQLGDFIIVYKDDQNQNYVIQAKKASDQDVYTNLTSDSVNDILLNDYEVNRSGSFYVNHPMAGEDTGMSFIYDTTTFSNDSPLDFLGGSLTSYSRIGQESFGSVENISLDDFY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
B3 domain-containing transcription factor FUS3 Transcription regulator involved in gene regulation during late embryogenesis. Its expression to the epidermis is sufficient to control foliar organ identity by regulating positively the synthesis abscisic acid (ABA) and negatively gibberellin production. Negatively regulates TTG1 in the embryo. Positively regulates the abundance of the ABI3 protein in the seed.probableQ9LW31

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:very confident
Coverage over the Query: 105-216
View the alignment between query and template
View the model in PyMOL