Citrus Sinensis ID: 041875


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MAFCGTQEKCKACDKTVHIIDMVTADGISYHKICFKCSHCNGKLVMGNFSSMEGVLYCKPHFEQLFKETGSFTNKLKPAQKNGLTRTPSKFSTMFCGTQDKCTSCKKTVYPLEKVTVEGESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHFAQLFKEKGCYNHLTKTASQKKIVAASADQNPEAEATEAKEH
cccccccccccccccEEEEcEEEEEccccccccccccccccccccccccCCccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHccccccccccccccccc
***CGTQEKCKACDKTVHIIDMVTADGISYHKICFKCSHCNGKLVMGNFSSMEGVLYCKPHFEQLFKETGSFTNKLKPAQKNGLTRTPSKFSTMFCGTQDKCTSCKKTVYPLEKVTVEGESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHFAQLFKEKGCYNHLTK**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFCGTQEKCKACDKTVHIIDMVTADGISYHKICFKCSHCNGKLVMGNFSSMEGVLYCKPHFEQLFKETGSFTNKLKPAQKNGLTRTPSKFSTMFCGTQDKCTSCKKTVYPLEKVTVEGESFHKTCFRCSHGGCLLTTSSYAALDGILYCKSHFAQLFKEKGCYNHLTKTASQKKIVAASADQNPEAEATEAKEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine and glycine-rich protein 3 Positive regulator of myogenesis. Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation.probableP50461
Cysteine and glycine-rich protein 3 Positive regulator of myogenesis. Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation.probableP50463
Cysteine and glycine-rich protein 3 Positive regulator of myogenesis. Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation.probableP50462

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B8T, chain A
Confidence level:very confident
Coverage over the Query: 1-167
View the alignment between query and template
View the model in PyMOL