Citrus Sinensis ID: 041877

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----

MMKRSMSFSGVNDKCHEDHHVHGDEDLSDDGSQVGEKKKRLNLEQVKALEKSFELGNKLEPERKLQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQFEALKADNDSLQAQNKKLHAELVSLKNKDSNNGQVIHLKKENEGSASNGSDNSSDINLDISRTQVITSPVSSSHLTSKQLFPTSTRPAAGSMTQLLQGSSIPDHLQCLKIDHHQMVQVQDESFCHMFNGIEEQQATASSFWQWPGQQNFH

ccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

******************************************LEQVKALEKSFELGNKLEPERKLQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQF***************************************************************************************************IPDHLQCLKIDHHQMVQVQDESFCHMFNGIEEQQATASSFWQWPGQQ***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MMKRSMSFSGVNDKCHEDHHVHGDEDLSDDGSQVGEKKKRLNLEQVKALEKSFELGNKLEPERKLQLARALGLQPRQIAIWFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDSNNGQVIHLKKENEGSASNGSDNSSDINLDISRTQVITSPVSSSHLTSKQLFPTSTRPAAGSMTQLLQGSSIPDHLQCLKIDHHQMVQVQDESFCHMFNGIEEQQATASSFWQWPGQQNFH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homeobox-leucine zipper protein ATHB-20	Probable transcription factor.	probable	Q8LAT0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PUF, chain A
Confidence level:very confident
Coverage over the Query: 32-94
View the alignment between query and template
View the model in PyMOL

Template: 1GU4, chain A
Confidence level:probable
Coverage over the Query: 86-133
View the alignment between query and template
View the model in PyMOL