BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 041888
         (326 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|O75486|SUPT3_HUMAN Transcription initiation protein SPT3 homolog OS=Homo sapiens
           GN=SUPT3H PE=1 SV=2
          Length = 399

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 53  LSPKPRPFPSICRPKCPEITTTHPQMMIFNNTCCIDTAPRSKVSEQYSPFALTTTTSNSS 112
           LSP PRPFPS+ R    +    HP +++  +       PR   +E  +  A   +T+ SS
Sbjct: 41  LSPPPRPFPSVSRAAAQKPHHLHPHILLAGSAAV---PPRVLKAEMNNTAASPMSTATSS 97


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.316    0.127    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 119,670,081
Number of Sequences: 539616
Number of extensions: 4960691
Number of successful extensions: 23744
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 222
Number of HSP's that attempted gapping in prelim test: 22411
Number of HSP's gapped (non-prelim): 1062
length of query: 326
length of database: 191,569,459
effective HSP length: 118
effective length of query: 208
effective length of database: 127,894,771
effective search space: 26602112368
effective search space used: 26602112368
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)