Citrus Sinensis ID: 041949

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

MAVASASLVISPRKLRSDVYSYSYENDSNTPLVISVLASLIERTMARNERIARNCRRALSKDSRSRVFDSHEIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQANPGFRIHATNVHRLLITTIMVASKYVEDLNYRNSYFARVGGLETNELNKLELDFLFLMGFKMHVNVSVFESYCCHLEREVSIGGGYHIERTLRCAEEIKSRQTEDRIFNHIARLTL

cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccEEEEccccHHHHHHHHHHHHHHcccccEEcHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccHHHHHHccccccc

*****************DVYSYSYENDSNTPLVISVLASLIERTMARNERIARNC************FDSHEIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQANPGFRIHATNVHRLLITTIMVASKYVEDLNYRNSYFARVGGLETNELNKLELDFLFLMGFKMHVNVSVFESYCCHLEREVSIGGGYHIERTLRCAEEIK******RIFNHI*RL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cyclin-U2-2		confident	Q9M205
Cyclin-P2-1		probable	Q7FAT5
Cyclin-U2-1		probable	Q9SHD3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PMI, chain B
Confidence level:very confident
Coverage over the Query: 30-51,63-186
View the alignment between query and template
View the model in PyMOL