Citrus Sinensis ID: 041964

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----

MVVIKWVFFTNPSNNNLPPSPSKLPIIGNLHQLGMTPHRSLTSLARLHGPIMLLQLGRERTFVISSPNFAREIMKTHDIIFANRPYSSIARKLLYDYRDLSWSPYGEYWRQMRSICVMRLLSTRRVQSFRSLREEETIQMIEKVALRSCSGSSPIDLSEILISLTNNVICRAAFGMTCGEGEAGGKLKKLLEELGELLGMFCVGDFIPWLAFLDKLTGLDARVERVFKHLDNFLNYVIDHHMTRQRQDVATNGGVIVKEDQKDFLDVLLEIQNDGTNGISMARENMKAIILDMFAGGTDTTYTALEWALTELIKHSKTMKKVQEEVRRIAGSKSYINEDHIEKMFYLKAVIKETLRLHPPVPLLLPRQATKDVQVGGYNIPAKSRVIINAWAIGRDPASWEEPEKFKPERFLDNCSSFKGNDFQFIPFGAGRRGCPGATFAIAIVELVLSNLLYKFDWALPGEQREEDLDVDESNGITIHRKFPLVVVATPHRF

cEEEEEEHHcccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHcccccccccccccHHHHHcccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccECHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccEEccEEcccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEECcccc

MVVIKWVFFTN***********KLPIIGNLHQLGMTPHRSLTSLARLHGPIMLLQLGRERTFVISSPNFAREIMKTHDIIFANRPYSSIARKLLYDYRDLSWSPYGEYWRQMRSICVMRLLSTRRVQSFRSLREEETIQMIEKVALRSCSGSSPIDLSEILISLTNNVICRAAFGMTCGEGEAGGKLKKLLEELGELLGMFCVGDFIPWLAFLDKLTGLDARVERVFKHLDNFLNYVIDHHMTRQ*************EDQKDFLDVLLEIQNDGTNGISMARENMKAIILDMFAGGTDTTYTALEWALTELIKHSKTMKKVQEEVRRIAGSKSYINEDHIEKMFYLKAVIKETLRLHPPVPLLLPRQATKDVQVGGYNIPAKSRVIINAWAIGRDPASWEEPEKFKPERFLDNCSSFKGNDFQFIPFGAGRRGCPGATFAIAIVELVLSNLLYKFDWALPGEQREEDLDVDESNGITIHRKFPLVVVATPHR*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome P450 71A6 (Fragment)		probable	O04164
Cytochrome P450 71A4	May have a role in maturation, such as during flavor formation or other metabolite production specific to aging tissues.	probable	P37117
Cytochrome P450 71A1	Involved in the metabolism of compounds associated with the development of flavor in the ripening fruit process, possibly by acting as trans-cinnamic acid 4-hydrolase.	probable	P24465

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PM0, chain A
Confidence level:very confident
Coverage over the Query: 35-493
View the alignment between query and template
View the model in PyMOL