Query         041979
Match_columns 254
No_of_seqs    127 out of 149
Neff          3.9 
Searched_HMMs 46136
Date          Fri Mar 29 12:44:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/041979.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/041979hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05627 AvrRpt-cleavage:  Clea  99.7 6.4E-19 1.4E-23  120.0   0.0   38  184-221     2-39  (39)
  2 PF05627 AvrRpt-cleavage:  Clea  99.3 4.4E-13 9.6E-18   91.5   1.2   31    5-35      6-39  (39)
  3 PF04939 RRS1:  Ribosome biogen  22.4      63  0.0014   28.5   2.1   27  195-221   125-151 (164)
  4 PF10380 CRF1:  Transcription f  14.2      89  0.0019   26.5   1.1   19    6-24     36-54  (123)
  5 TIGR02689 ars_reduc_gluta arse   9.8 2.7E+02  0.0058   22.3   2.5   26  190-217    92-117 (126)
  6 cd05806 CBM20_laforin Laforin    9.3 1.3E+02  0.0028   24.7   0.5   14    5-18     22-35  (112)
  7 PF08168 NUC205:  NUC205 domain   9.2 1.6E+02  0.0035   21.0   0.9   11   36-46     33-43  (44)
  8 cd05808 CBM20_alpha_amylase Al   8.8 1.1E+02  0.0023   22.9  -0.2   16    5-20     21-36  (95)
  9 PF00686 CBM_20:  Starch bindin   8.6 1.1E+02  0.0024   23.2  -0.1   15    6-20     23-37  (96)
 10 COG0394 Wzb Protein-tyrosine-p   8.4   2E+02  0.0043   24.1   1.3   28  192-219   103-132 (139)

No 1  
>PF05627 AvrRpt-cleavage:  Cleavage site for pathogenic type III effector avirulence factor Avr;  InterPro: IPR008700  This domain is conserved in small families of otherwise unrelated proteins in both mono-cots and di-cots, suggesting that it has a conserved, plant-specific function. It is found both in the plant RIN4 (resistance R membrane-bound host-target protein) where it appears to contribute to the binding of the protein to both RCS (AvrRpt2 auto-cleavage site) and AvrB, the virulence factor from the infecting bacterium []. The cleavage site for the AvrRpt2 avirulence protein would appear to be the sequence motifs VPQFGDW and LPKFGEW, both of which are highly conserved within the domain []. ; PDB: 2NUD_C.
Probab=99.72  E-value=6.4e-19  Score=120.05  Aligned_cols=38  Identities=63%  Similarity=1.235  Sum_probs=13.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCceehhHHHHHHHhhc
Q 041979          184 PDKGAAVPKFGDWDENNPSSADGYTHIFNQVREERNSA  221 (254)
Q Consensus       184 ~~~~~~vPkFG~WD~~np~s~~~yT~iF~k~r~ekk~~  221 (254)
                      +.++.+|||||+||++||++|++|||||+|||+|||++
T Consensus         2 ~~~~~~vPkFG~WD~~~~~~~~~yT~iF~kar~~Kk~~   39 (39)
T PF05627_consen    2 PQKGSHVPKFGEWDENNPASAEGYTVIFEKAREEKKTG   39 (39)
T ss_dssp             ----------SGGGTT-TT---SS-EEEE---------
T ss_pred             CcCCCCCCCCCcccCCCCCCCCCeeehHHHHhhhccCC
Confidence            56789999999999999999999999999999999974


No 2  
>PF05627 AvrRpt-cleavage:  Cleavage site for pathogenic type III effector avirulence factor Avr;  InterPro: IPR008700  This domain is conserved in small families of otherwise unrelated proteins in both mono-cots and di-cots, suggesting that it has a conserved, plant-specific function. It is found both in the plant RIN4 (resistance R membrane-bound host-target protein) where it appears to contribute to the binding of the protein to both RCS (AvrRpt2 auto-cleavage site) and AvrB, the virulence factor from the infecting bacterium []. The cleavage site for the AvrRpt2 avirulence protein would appear to be the sequence motifs VPQFGDW and LPKFGEW, both of which are highly conserved within the domain []. ; PDB: 2NUD_C.
Probab=99.31  E-value=4.4e-13  Score=91.53  Aligned_cols=31  Identities=48%  Similarity=1.045  Sum_probs=11.9

Q ss_pred             CCCCCCCCccCCCCcc---ceeeecccccCCCCC
Q 041979            5 SHVPKFGNWENEDNVP---YTMYFDKARKGRTGG   35 (254)
Q Consensus         5 ~~vPkFG~Wd~~~~~p---yT~~Fe~aR~~k~~g   35 (254)
                      ++|||||+||.++..+   ||+||++||++|++|
T Consensus         6 ~~vPkFG~WD~~~~~~~~~yT~iF~kar~~Kk~~   39 (39)
T PF05627_consen    6 SHVPKFGEWDENNPASAEGYTVIFEKAREEKKTG   39 (39)
T ss_dssp             ------SGGGTT-TT---SS-EEEE---------
T ss_pred             CCCCCCCcccCCCCCCCCCeeehHHHHhhhccCC
Confidence            5899999999987655   999999999999864


No 3  
>PF04939 RRS1:  Ribosome biogenesis regulatory protein (RRS1);  InterPro: IPR007023 This is a family of eukaryotic ribosomal biogenesis regulatory proteins.; GO: 0042254 ribosome biogenesis, 0005634 nucleus
Probab=22.35  E-value=63  Score=28.46  Aligned_cols=27  Identities=26%  Similarity=0.384  Sum_probs=21.4

Q ss_pred             CCCCCCCCCCCCceehhHHHHHHHhhc
Q 041979          195 DWDENNPSSADGYTHIFNQVREERNSA  221 (254)
Q Consensus       195 ~WD~~np~s~~~yT~iF~k~r~ekk~~  221 (254)
                      +|=.--+..++-|...|.+.|++|+..
T Consensus       125 ~wiiEv~~~~~~~eDpf~~~~~eKker  151 (164)
T PF04939_consen  125 DWIIEVKPNDDPGEDPFEKKREEKKER  151 (164)
T ss_pred             CceEEcCCCCCCCcCHHHHHHHHHHHH
Confidence            455554667789999999999999864


No 4  
>PF10380 CRF1:  Transcription factor CRF1;  InterPro: IPR018837  CRF1 is a transcription factor that co-represses ribosomal genes with FHL1 via the TOR signalling pathway and protein kinase A []. 
Probab=14.22  E-value=89  Score=26.52  Aligned_cols=19  Identities=26%  Similarity=0.768  Sum_probs=16.3

Q ss_pred             CCCCCCCccCCCCccceee
Q 041979            6 HVPKFGNWENEDNVPYTMY   24 (254)
Q Consensus         6 ~vPkFG~Wd~~~~~pyT~~   24 (254)
                      ..|++|.|-..++-||..+
T Consensus        36 rPP~LGtWv~~d~KPFgII   54 (123)
T PF10380_consen   36 RPPVLGTWVTTDSKPFGII   54 (123)
T ss_pred             CCCeeeeeeccCCccceee
Confidence            5799999976699999876


No 5  
>TIGR02689 ars_reduc_gluta arsenate reductase, glutathione/glutaredoxin type. Members of this protein family represent a novel form of arsenate reductase, using glutathione and glutaredoxin rather than thioredoxin for reducing equivalents as do some homologous arsenate reductases. An example of this type is Synechocystis sp. strain PCC 6803 slr0946, and of latter type (excluded from this model) is Staphylococcus aureus plasmid pI258 ArsC. Both are among the subset of arsenate reductases that belong the the low-molecular-weight protein-tyrosine phosphatase superfamily.
Probab=9.85  E-value=2.7e+02  Score=22.29  Aligned_cols=26  Identities=31%  Similarity=0.685  Sum_probs=18.2

Q ss_pred             CCCCCCCCCCCCCCCCCceehhHHHHHH
Q 041979          190 VPKFGDWDENNPSSADGYTHIFNQVREE  217 (254)
Q Consensus       190 vPkFG~WD~~np~s~~~yT~iF~k~r~e  217 (254)
                      +..++.||..||..  +....|.+++++
T Consensus        92 ~~~~~~w~i~DP~~--~~~~~f~~~~~~  117 (126)
T TIGR02689        92 REIFEDWQLEDPDG--QSIEVFRRVRDE  117 (126)
T ss_pred             CceeecCCCCCCCC--CcHHHHHHHHHH
Confidence            45679999999953  345566666665


No 6  
>cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain. Laforin, encoded by the EPM2A gene, is a dual-specificity phosphatase that dephosphorylates complex carbohydrates. Mutations in the gene encoding laforin result in Lafora disease, a fatal autosomal recessive neurodegenerative disorder characterized by the presence of intracellular deposits of insoluble, abnormally branched, glycogen-like polymers, known as Lafora bodies, in neurons, muscle, liver, and other tissues. The molecular basis for the formation of these Lafora bodies is unknown. Laforin is one of the only phosphatases that contains a carbohydrate-binding module. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen
Probab=9.34  E-value=1.3e+02  Score=24.66  Aligned_cols=14  Identities=21%  Similarity=0.800  Sum_probs=10.7

Q ss_pred             CCCCCCCCccCCCC
Q 041979            5 SHVPKFGNWENEDN   18 (254)
Q Consensus         5 ~~vPkFG~Wd~~~~   18 (254)
                      +.+|.+|+|+....
T Consensus        22 GsipeLG~Wd~~~A   35 (112)
T cd05806          22 GSRPELGSWDPQRA   35 (112)
T ss_pred             ECchhcCCCCcccc
Confidence            46999999986443


No 7  
>PF08168 NUC205:  NUC205 domain;  InterPro: IPR012584 This domain is found in a novel family of nucleolar proteins [].; GO: 0005634 nucleus
Probab=9.16  E-value=1.6e+02  Score=21.02  Aligned_cols=11  Identities=55%  Similarity=0.960  Sum_probs=9.6

Q ss_pred             CcCCCCCCCCC
Q 041979           36 TMINPNDPQEN   46 (254)
Q Consensus        36 ~~~NPNDP~en   46 (254)
                      .+|+|.||+||
T Consensus        33 ip~~~~d~een   43 (44)
T PF08168_consen   33 IPISPKDPEEN   43 (44)
T ss_pred             ccccCCCcccC
Confidence            57899999987


No 8  
>cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. This domain is found in several bacterial and fungal alpha-amylases including the maltopentaose-forming amylases (G5-amylases). Most alpha-amylases have, in addition to the C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13, which hydrolyzes internal alpha-1,4-glucosidic bonds in starch and related saccharides, yielding maltotriose and maltose. Two types of soluble substrates are used by alpha-amylases including long substrates (e.g. amylose) and short substrates (e.g. maltodextrins or maltooligosaccharides). The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. lafo
Probab=8.76  E-value=1.1e+02  Score=22.94  Aligned_cols=16  Identities=38%  Similarity=0.943  Sum_probs=10.9

Q ss_pred             CCCCCCCCccCCCCcc
Q 041979            5 SHVPKFGNWENEDNVP   20 (254)
Q Consensus         5 ~~vPkFG~Wd~~~~~p   20 (254)
                      +.+|.||+|+....++
T Consensus        21 G~~~~lG~W~~~~a~~   36 (95)
T cd05808          21 GNVPELGNWSPANAVA   36 (95)
T ss_pred             eCcHHhCCCChhhCcc
Confidence            3578999998644333


No 9  
>PF00686 CBM_20:  Starch binding domain;  InterPro: IPR002044 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This domain binds to starch, and is found often at the C terminus of a variety of glycosyl hydrolases acting on polysaccharides more rapidly than on oligosaccharides. Reations include: the hydrolysis of terminal 1,4-linked alpha-D-glucose residues successively from non-reducing ends of the chains with release of beta-D-glucose, the degradation of starch to cyclodextrins by formation of a 1,4-alpha-D-glucosidic bond, and hydrolysis of 1,4-alpha-glucosidic linkages in polysaccharides to remove successive maltose units from the non-reducing ends of the chains.; GO: 0003824 catalytic activity, 0005975 carbohydrate metabolic process; PDB: 1KUL_A 1ACZ_A 1AC0_A 1KUM_A 2Z0B_C 9CGT_A 3CGT_A 6CGT_A 4CGT_A 1CGT_A ....
Probab=8.61  E-value=1.1e+02  Score=23.18  Aligned_cols=15  Identities=40%  Similarity=1.097  Sum_probs=11.0

Q ss_pred             CCCCCCCccCCCCcc
Q 041979            6 HVPKFGNWENEDNVP   20 (254)
Q Consensus         6 ~vPkFG~Wd~~~~~p   20 (254)
                      ..|.+|+|+....++
T Consensus        23 s~~~LG~W~~~~a~~   37 (96)
T PF00686_consen   23 SCPELGNWDPKKAVP   37 (96)
T ss_dssp             SSGGGTTTSGGGSBE
T ss_pred             CcHHhCCCChHhccc
Confidence            578999999754443


No 10 
>COG0394 Wzb Protein-tyrosine-phosphatase [Signal transduction mechanisms]
Probab=8.37  E-value=2e+02  Score=24.06  Aligned_cols=28  Identities=7%  Similarity=0.514  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCCCCC--CceehhHHHHHHHh
Q 041979          192 KFGDWDENNPSSAD--GYTHIFNQVREERN  219 (254)
Q Consensus       192 kFG~WD~~np~s~~--~yT~iF~k~r~ekk  219 (254)
                      .+-.||..||..+.  .|...|..|++.=+
T Consensus       103 ~~~~~~v~DP~~~~~e~~~~~~~~i~~~~~  132 (139)
T COG0394         103 EYEHWEVPDPYYGSGEEFEEVYRLIEDAIK  132 (139)
T ss_pred             cccCCCCCCCCCCchHHHHHHHHHHHHHHH
Confidence            34449999998754  89999999988643


Done!