BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 041980
(128 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1OYJ|A Chain A, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In
Complex With Glutathione.
pdb|1OYJ|B Chain B, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In
Complex With Glutathione.
pdb|1OYJ|C Chain C, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In
Complex With Glutathione.
pdb|1OYJ|D Chain D, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In
Complex With Glutathione
Length = 231
Score = 25.4 bits (54), Expect = 9.9, Method: Compositional matrix adjust.
Identities = 12/36 (33%), Positives = 23/36 (63%)
Query: 52 PQLEAELRRTARPDSLMMGQVNRERLAEYLGELQRK 87
P+L A RR R DS++ + E++ +++G L++K
Sbjct: 192 PRLAAWARRCGRIDSVVKHLPSPEKVYDFVGVLKKK 227
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.130 0.379
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,214,768
Number of Sequences: 62578
Number of extensions: 97574
Number of successful extensions: 203
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 200
Number of HSP's gapped (non-prelim): 7
length of query: 128
length of database: 14,973,337
effective HSP length: 87
effective length of query: 41
effective length of database: 9,529,051
effective search space: 390691091
effective search space used: 390691091
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)