Citrus Sinensis ID: 042006


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
AINDSQVKCSRTCVAENCNSVGIRYRKYCRVGWSDCHGEKPCDDLDACCKIHDECVDKKGLTNIKCHEKFKRCIKKVQKSGNVGFSYKCPYDTVVPTMVQGMDMAILLRANLVMLQFLK
ccccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
**********RTCVAENCNSVGIRYRKYCRVGWSDCHGEKPCDDLDACCKIHDECVDKKGLTNIKCHEKFKRCIKKVQKSGNVGFSYKCPYDTVVPTMVQGMDMAILLRANLVMLQFLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AINDSQVKCSRTCVAENCNSVGIRYRKYCRVGWSDCHGEKPCDDLDACCKIHDECVDKKGLTNIKCHEKFKRCIKKVQKSGNVGFSYKCPYDTVVPTMVQGMDMAILLRANLVMLQFLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable phospholipase A2 homolog 1 PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (By similarity). Releases lysophospholipids (LPLs) and free fatty acids (FFAs) from membrane phospholipids in response to hormones and other external stimuli.probableQ9XG80

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WG7, chain A
Confidence level:very confident
Coverage over the Query: 4-114
View the alignment between query and template
View the model in PyMOL